RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.4 bits (63), Expect = 0.45 Identities = 8/50 (16%), Positives = 16/50 (32%), Gaps = 26/50 (52%) Query: 13 ALV-----FVIT-------------RGV--------ARLPKDQKKAFFRH 36 +LV V++ R +R+P ++K F + Sbjct: 369 SLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSN 418 >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, polymorphism, receptor, transcription, transcription regulation; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Score = 26.1 bits (56), Expect = 1.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Query: 31 KAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKY 65 K FFR + + L Y+ D I K + +C+Y Sbjct: 74 KGFFR--RTIRLKLIYDRCDLNCRIHKKSRNKCQY 106 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.136 0.389 Gapped Lambda K H 0.267 0.0627 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 658,874 Number of extensions: 24636 Number of successful extensions: 74 Number of sequences better than 10.0: 1 Number of HSP's gapped: 74 Number of HSP's successfully gapped: 4 Length of query: 85 Length of database: 5,693,230 Length adjustment: 53 Effective length of query: 32 Effective length of database: 4,408,298 Effective search space: 141065536 Effective search space used: 141065536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.3 bits)