Query gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 225 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 05:10:56 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781128.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK10808 outer membrane protei 72.7 1.3 3.3E-05 24.4 0.6 49 176-225 146-195 (347) 2 pfam01389 OmpA_membrane OmpA-l 57.1 2.3 5.9E-05 22.9 -0.6 49 175-225 124-174 (175) 3 pfam07071 DUF1341 Protein of u 54.8 5 0.00013 20.9 0.8 14 101-114 176-189 (218) 4 TIGR03581 EF_0839 conserved hy 51.8 6.2 0.00016 20.4 0.9 17 100-116 175-191 (236) 5 pfam02182 YDG_SRA YDG/SRA doma 38.5 17 0.00042 17.8 1.4 130 78-225 7-146 (154) 6 PRK10115 protease 2; Provision 37.1 32 0.00082 16.1 2.7 27 77-105 128-155 (686) 7 TIGR01073 pcrA ATP-dependent D 34.5 10 0.00026 19.1 -0.2 18 140-157 299-316 (811) 8 TIGR01368 CPSaseIIsmall carbam 32.6 39 0.001 15.6 2.5 29 87-127 5-33 (383) 9 CHL00174 accD acetyl-CoA carbo 29.2 24 0.00061 16.9 0.9 55 138-194 248-304 (305) 10 KOG4399 consensus 22.1 22 0.00057 17.1 -0.3 58 20-94 148-206 (325) 11 TIGR00069 hisD histidinol dehy 20.7 27 0.0007 16.5 -0.1 52 21-80 350-402 (435) 12 KOG0754 consensus 20.1 69 0.0018 14.1 1.9 50 147-218 186-235 (294) 13 pfam01828 Peptidase_A4 Peptida 20.1 50 0.0013 15.0 1.2 32 110-143 46-77 (208) No 1 >PRK10808 outer membrane protein A; Reviewed Probab=72.69 E-value=1.3 Score=24.43 Aligned_cols=49 Identities=24% Similarity=0.345 Sum_probs=34.0 Q ss_pred HHHHCCHHHHHHHHHHCCCCEEEEEEE-CCCCCHHHHHHCCCCCEEEEEEC Q ss_conf 765033267777753003533588961-68765455543067000057849 Q gi|254781128|r 176 KVIGVGIEKKLASMLSIRGEYRYVACY-DQPWDVSKWREKGDFTAGVVLRF 225 (225) Q Consensus 176 kvigvgiekklasmlsirgeyryvacy-dqpwdvskwrekgdftagvvlrf 225 (225) -..|+|+|-.+..-++.|.||||+.-. |..+.-.++ .-+.++.|+..|| T Consensus 146 ~~~g~GveY~lt~~~~~R~eYq~~~~igd~~~~g~~~-d~~~~slGlsY~F 195 (347) T PRK10808 146 PVFAGGVEYAITPEWATRLEYQWTNNIGDANTIGTRP-DNGLLSVGVSYRF 195 (347) T ss_pred CEEEEEEEEEECCCCEEEEEEEEEEECCCCCCCCCCC-CCCEEEEEEEECC T ss_conf 2067203588063726888899981057555557467-7756999999637 No 2 >pfam01389 OmpA_membrane OmpA-like transmembrane domain. The structure of OmpA transmembrane domain shows that it consists of an eight stranded beta barrel. This family includes some other distantly related outer membrane proteins with low scores. Probab=57.07 E-value=2.3 Score=22.91 Aligned_cols=49 Identities=22% Similarity=0.430 Sum_probs=33.8 Q ss_pred HHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHH--HCCCCCEEEEEEC Q ss_conf 77650332677777530035335889616876545554--3067000057849 Q gi|254781128|r 175 DKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWR--EKGDFTAGVVLRF 225 (225) Q Consensus 175 dkvigvgiekklasmlsirgeyryvacydqpwdvskwr--ekgdftagvvlrf 225 (225) .-+.|+|+|-.+..-+++|-||+|..-.. .+..... .-.-++.|+.-|| T Consensus 124 ~~~~G~G~eY~it~~~~~r~eYq~~~~~g--~~~~~~~~~D~~~~slGlsYrF 174 (175) T pfam01389 124 SPLFALGVEYAVTPELAVRLEYQYLNNIG--DLHKQGKRPDNGSASLGISYRF 174 (175) T ss_pred CEEEEEEEEEEECCCCEEEEEEEEEHHCC--CCCCCCCCCCCCEEEEEEEEEC T ss_conf 53888888998075827888899922258--5335676677777999999777 No 3 >pfam07071 DUF1341 Protein of unknown function (DUF1341). This family consists of several hypothetical bacterial proteins of around 220 residues in length. The function of this family is unknown. Probab=54.75 E-value=5 Score=20.93 Aligned_cols=14 Identities=71% Similarity=1.165 Sum_probs=6.4 Q ss_pred CEEEECCCCCCCCC Q ss_conf 20232355777700 Q gi|254781128|r 101 EGFHLEPRGGIDGD 114 (225) Q Consensus 101 egfhleprggidgd 114 (225) +||-|||.||||-| T Consensus 176 ~g~~lEPTGGIdl~ 189 (218) T pfam07071 176 HGFYLEPTGGIDLD 189 (218) T ss_pred CCCEECCCCCCCHH T ss_conf 69366667884677 No 4 >TIGR03581 EF_0839 conserved hypothetical protein EF_0839/AHA_3917. Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. Probab=51.77 E-value=6.2 Score=20.36 Aligned_cols=17 Identities=59% Similarity=0.944 Sum_probs=12.1 Q ss_pred CCEEEECCCCCCCCCCE Q ss_conf 32023235577770001 Q gi|254781128|r 100 VEGFHLEPRGGIDGDKV 116 (225) Q Consensus 100 vegfhleprggidgdkv 116 (225) -+||-|||.||||-|.. T Consensus 175 ~~g~~lEPTGGIdl~N~ 191 (236) T TIGR03581 175 KHGFYLEPTGGIDLDNF 191 (236) T ss_pred HCCEEECCCCCCCHHHH T ss_conf 76915666798567779 No 5 >pfam02182 YDG_SRA YDG/SRA domain. The function of this domain is unknown, it contains a conserved motif YDG after which it has been named. Probab=38.52 E-value=17 Score=17.81 Aligned_cols=130 Identities=30% Similarity=0.450 Sum_probs=62.1 Q ss_pred ECCEEEEECCCCCCEEEECCCCCCEEEECCCCCCCCCCEEE-----EEEEEEEEEECCCCHHHEEEEEEEEECCHHHHHE Q ss_conf 23247663177750786111243202323557777000123-----6676410122078501000001133252321000 Q gi|254781128|r 78 LNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAG-----TLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNI 152 (225) Q Consensus 78 lngvsigldgqdgtlvygaslgvegfhleprggidgdkvag-----tllfrtgftfdnnnssilqntliygfggarirni 152 (225) +.||.+|- ..-|-..|-+.|.|..+.+|||+.+..| ....--|+.=|-.+ -++++|-=-|.+-++- T Consensus 7 ipGv~VGd-----~f~~R~el~~~GlH~~~~~GI~g~~~~g~~~A~SIV~SGgYedD~D~----gd~l~YTG~GG~~~~~ 77 (154) T pfam02182 7 VPGVEVGD-----IFFFRVELCVVGLHRPHQAGIDGMKGEGGTLATSIVLSGGYEDDEDN----GDVLVYTGQGGNDLTK 77 (154) T ss_pred CCCCCCCC-----EECCHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCC----CCEEEEECCCCCCCCC T ss_conf 99832876-----88168999984777753378122247898117999986998777778----9789997889976888 Q ss_pred EECCCCCHHHH----HHHHHHHHHHHHHHHHCCHHHHHHHHHHC-CCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC Q ss_conf 11022202578----89988641006776503326777775300-353358896168765455543067000057849 Q gi|254781128|r 153 MSVESADTAKS----TIRNIVANGFLDKVIGVGIEKKLASMLSI-RGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF 225 (225) Q Consensus 153 msvesadtaks----tirnivangfldkvigvgiekklasmlsi-rgeyryvacydqpwdvskwrekgdftagvvlrf 225 (225) ...+|..-. .+.+-...+..-.||- -.|..+-.+- -+-|||--.|. -+..|+|+|..- ..|.|| T Consensus 78 --~q~~dQ~l~~gNlAL~~S~~~~~PVRViR---g~~~~~~~~p~~~~yrYDGLY~---V~~~w~e~g~~G-~~v~kf 146 (154) T pfam02182 78 --KQAEDQKLERGNLALANSMRKGNPVRVIR---GEKDASSYAPKGGVYRYDGLYR---VEKYWREKGKSG-FKVFKF 146 (154) T ss_pred --CCCCCCCCCHHHHHHHHHHHHCCCEEEEE---EECCCCCCCCCCCCEEECCEEE---EEEEEEEECCCC-CEEEEE T ss_conf --74565440025699999987099658997---3025776787788568461889---999998207887-689999 No 6 >PRK10115 protease 2; Provisional Probab=37.07 E-value=32 Score=16.10 Aligned_cols=27 Identities=19% Similarity=0.393 Sum_probs=11.3 Q ss_pred EECCEEEEECCCCCCEEEECCC-CCCEEEE Q ss_conf 3232476631777507861112-4320232 Q gi|254781128|r 77 SLNGVSIGLDGQDGTLVYGASL-GVEGFHL 105 (225) Q Consensus 77 slngvsigldgqdgtlvygasl-gvegfhl 105 (225) +|-++++.-||+ .+.|+.+. |.|-+-+ T Consensus 128 ~l~~~~~SpDg~--~lAys~d~~Gse~~~i 155 (686) T PRK10115 128 TLGGMAITPDNT--IMALAEDFLSRRQYGL 155 (686) T ss_pred EEEEEEECCCCC--EEEEEEECCCCEEEEE T ss_conf 970389889997--7879982698669999 No 7 >TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751 The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli. The action of the 3'5' bacterial DNA helicase is based upon two separate but coupled activities, ssDNA translocation and duplex destabilisation, and is driven by energy derived from the continuous ATP-binding and hydrolysis events that take place in the active-site cleft. The resulting conformational changes that accompany these events underpin the coupling process and allow the helicase to translocate along the DNA, destabilising the duplex and separating the two strands in an active process .; GO: 0004003 ATP-dependent DNA helicase activity, 0006268 DNA unwinding during replication, 0005737 cytoplasm. Probab=34.51 E-value=10 Score=19.08 Aligned_cols=18 Identities=56% Similarity=0.888 Sum_probs=15.7 Q ss_pred EEEEECCHHHHHEEECCC Q ss_conf 113325232100011022 Q gi|254781128|r 140 LIYGFGGARIRNIMSVES 157 (225) Q Consensus 140 liygfggarirnimsves 157 (225) =||||-||-|+||++-|. T Consensus 299 SIY~wRGAdi~NIL~FEk 316 (811) T TIGR01073 299 SIYGWRGADITNILSFEK 316 (811) T ss_pred CCHHHHCCHHHHHHHHHH T ss_conf 500120101563320100 No 8 >TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains . This entry represents the small subunit of the glutamine-dependent form (6.3.5.5 from EC) of carbamoyl phosphate synthase, CPSase II. The small subunit catalyses the hydrolysis of glutamine to ammonia, which in turn used by the large chain to synthesize carbamoyl phosphate. The C-terminal domain of the small subunit of CPSase has glutamine amidotransferase activity. Note that the sequence from the mammalian urea cycle form has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I (6.3.4.16 from EC). CPSases of pyrimidine biosynthesis, arginine biosynthesis, and the urea cycle may be encoded by one or by several genes, depending on the species. ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process. Probab=32.56 E-value=39 Score=15.59 Aligned_cols=29 Identities=52% Similarity=0.831 Sum_probs=24.0 Q ss_pred CCCCCEEEECCCCCCEEEECCCCCCCCCCEEEEEEEEEEEE Q ss_conf 77750786111243202323557777000123667641012 Q gi|254781128|r 87 GQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFT 127 (225) Q Consensus 87 gqdgtlvygaslgvegfhleprggidgdkvagtllfrtgft 127 (225) =+|||.-.|-|.|-++ .++|-+.|-||.| T Consensus 5 LeDGt~f~G~sFGa~~------------~~~GE~VFnTgMT 33 (383) T TIGR01368 5 LEDGTVFEGYSFGAEG------------TVAGEVVFNTGMT 33 (383) T ss_pred CCCCCEEEEEEECCCC------------CEEEEEEEECCCC T ss_conf 1378777888845666------------5488898836897 No 9 >CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Probab=29.16 E-value=24 Score=16.90 Aligned_cols=55 Identities=15% Similarity=0.375 Sum_probs=33.8 Q ss_pred EEEEEEECCHHH-HHEEECCCCCHHHHHHHHHHHHHHHHHHHHC-CHHHHHHHHHHCCC Q ss_conf 001133252321-0001102220257889988641006776503-32677777530035 Q gi|254781128|r 138 NTLIYGFGGARI-RNIMSVESADTAKSTIRNIVANGFLDKVIGV-GIEKKLASMLSIRG 194 (225) Q Consensus 138 ntliygfggari-rnimsvesadtakstirnivangfldkvigv-giekklasmlsirg 194 (225) +.+ .||.|.|+ .+.+..+- ...-.|-.....+||+|.|+-- -+..+|+..|+|.| T Consensus 248 ~Al-IGFAG~RVIeqTi~~~L-PegFQtaEfllehG~iD~IV~R~~lk~~l~~lL~ih~ 304 (305) T CHL00174 248 NAY-IAFAGKRVIEQTLNKTV-PEGSQAAEYLFHKGLFDLIVPRNLLKGVLSELFQLHG 304 (305) T ss_pred CCE-EEECCCHHHHHHHCCCC-CCCCCCHHHHHHCCCCCEEECHHHHHHHHHHHHHHHC T ss_conf 866-76056178888618989-9863226999977997167658999999999998647 No 10 >KOG4399 consensus Probab=22.10 E-value=22 Score=17.06 Aligned_cols=58 Identities=28% Similarity=0.374 Sum_probs=37.8 Q ss_pred HHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCEEEEEECHHHCCCCCCEEE-EEEEECCEEEEECCCCCCEEE Q ss_conf 878886520012201476875311487513011011477632211244486155-123323247663177750786 Q gi|254781128|r 20 SGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRL-QNLSLNGVSIGLDGQDGTLVY 94 (225) Q Consensus 20 sglflgffssaamadygyspqfqptimvsnfakfkglyvaadfskidhqspvrl-qnlslngvsigldgqdgtlvy 94 (225) ..-|--||.|-.|+||. ..+.||+-.+.- |+.-.|||||. .|..-|-|+.| ...++-| T Consensus 148 e~R~~qFFPS~Q~~~Y~--------~~~D~~~~~~~~------~~~~~q~~~r~~~~i~~~~i~~~---~EE~~~~ 206 (325) T KOG4399 148 ESRICQFFPSFQMLDYQ--------VDYDNHALYKHG------KTGRKQSPVRIFTNIPPNKIILP---TEEGYRF 206 (325) T ss_pred HHHHHHHCCHHHHHHHH--------HHHHHHHHHHHC------CCCCCCCHHHHHHCCCCCEEECC---CCCCEEE T ss_conf 77899867517655440--------003457777612------33224756689752897504346---5124589 No 11 >TIGR00069 hisD histidinol dehydrogenase; InterPro: IPR001692 Histidinol dehydrogenase (1.1.1.23 from EC) (HDH) catalyses the terminal step in the biosynthesis of histidine in bacteria, fungi, and plants, the four-electron oxidation of L-histidinol to histidine. In 4-electron dehydrogenases, a single active site catalyses 2 separate oxidation steps: oxidation of the substrate alcohol to an intermediate aldehyde; and oxidation of the aldehyde to the product acid, in this case His . The reaction proceeds via a tightly- or covalently-bound inter-mediate, and requires the presence of 2 NAD molecules . By contrast with most dehydrogenases, the substrate is bound before the NAD coenzyme . A Cys residue has been implicated in the catalytic mechanism of the second oxidative step . In bacteria HDH is a single chain polypeptide; in fungi it is the C-terminal domain of a multifunctional enzyme which catalyzes three different steps of histidine biosynthesis; and in plants it is expressed as nuclear encoded protein precursor which is exported to the chloroplast .; GO: 0004399 histidinol dehydrogenase activity, 0000105 histidine biosynthetic process. Probab=20.72 E-value=27 Score=16.54 Aligned_cols=52 Identities=29% Similarity=0.510 Sum_probs=36.2 Q ss_pred HHHHHHHHHHHHHCCCCCCCC-CEEEEEECCHHHCEEEEEECHHHCCCCCCEEEEEEEECC Q ss_conf 788865200122014768753-114875130110114776322112444861551233232 Q gi|254781128|r 21 GLFLGFFSSAAMADYGYSPQF-QPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNG 80 (225) Q Consensus 21 glflgffssaamadygyspqf-qptimvsnfakfkglyvaadfskidhqspvrlqnlslng 80 (225) -.|||-||.-++.||.--+.. -|| +.||++-.=---+||.|- .-+|+||-.| T Consensus 350 siFLG~ySP~s~GDYaSGTNHVLPT---~GyAr~ySgL~v~dF~K~-----~T~q~lt~eg 402 (435) T TIGR00069 350 SIFLGEYSPESAGDYASGTNHVLPT---YGYARMYSGLSVEDFLKK-----ITVQELTKEG 402 (435) T ss_pred EEEECCCCCCCCCCCCCCCCCCCCC---CCHHHHCCCCCHHHHHHH-----HHHHCCCHHH T ss_conf 1354576755545477888765776---541432155322222002-----3141148889 No 12 >KOG0754 consensus Probab=20.15 E-value=69 Score=14.12 Aligned_cols=50 Identities=32% Similarity=0.418 Sum_probs=28.9 Q ss_pred HHHHHEEECCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCC Q ss_conf 321000110222025788998864100677650332677777530035335889616876545554306700 Q gi|254781128|r 147 ARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFT 218 (225) Q Consensus 147 arirnimsvesadtakstirnivangfldkvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdft 218 (225) -.+||++.+ +.+....+||-+.-|++ .-.+|+++++ |.||.|-|-.|+-. T Consensus 186 ~~vrn~vP~--~k~~~~~~~~~~i~g~l--------~gtla~~ln~------------pfDVaKsRIQgpqp 235 (294) T KOG0754 186 YQVRNSVPS--AKDKTLEIRRKLIIGAL--------AGTLACVLNT------------PFDVAKSRIQGPQP 235 (294) T ss_pred HHHHHHCCC--CCCCHHHHHHHHHHHHH--------HHHHHHHCCC------------HHHHHHHHCCCCCC T ss_conf 878761787--65738999999999885--------1021221137------------06776752358999 No 13 >pfam01828 Peptidase_A4 Peptidase A4 family. Probab=20.15 E-value=50 Score=14.97 Aligned_cols=32 Identities=31% Similarity=0.560 Sum_probs=14.2 Q ss_pred CCCCCCEEEEEEEEEEEEECCCCHHHEEEEEEEE Q ss_conf 7770001236676410122078501000001133 Q gi|254781128|r 110 GIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYG 143 (225) Q Consensus 110 gidgdkvagtllfrtgftfdnnnssilqntliyg 143 (225) |||||.-...|| .+|..|.-+| ...+...-|- T Consensus 46 GIDGdt~~~alL-Q~Gvd~~~~n-G~~sy~AWyE 77 (208) T pfam01828 46 GIDGDTCSNAIL-QTGVDFYVED-GEVSYDAWYE 77 (208) T ss_pred ECCCCCCCCCEE-EEEEEEEECC-CCEEEEEEEE T ss_conf 426887787537-6169999879-9899989999 Done!