RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62] (225 letters) >gnl|CDD|37748 KOG2537, KOG2537, KOG2537, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism]. Length = 539 Score = 29.1 bits (65), Expect = 0.92 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Query: 58 VAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVA 117 ADF K + P L + N DG LVY FHL +DGDK+A Sbjct: 256 CGADFVKTKQKPPKGLSPIKANTRCASFDGDADRLVYFYIDDDSEFHL-----LDGDKIA 310 >gnl|CDD|33435 COG3637, COG3637, Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane]. Length = 199 Score = 27.7 bits (61), Expect = 2.9 Identities = 35/218 (16%), Positives = 60/218 (27%), Gaps = 30/218 (13%) Query: 16 KIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQN 75 + + L S+AA AD + + G Y +D+S D + Sbjct: 4 LLAAAALAALLLSAAAAADAAAG----------WYGTYSGGYAGSDWSGSDSSPSI---G 50 Query: 76 LSLNGVSIGLDGQDGTLVYGASL-----GVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDN 130 G + + V G G G + G D A R G + Sbjct: 51 FGGGLKLAGYNLKYRYSVLGVEGSFTYTGQSGRYSGGSGKNQVDNKAWYGSLRAGPDYRI 110 Query: 131 NNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASML 190 N+ YG G + + + S + G+ G G++ + Sbjct: 111 ND-----RFSPYGGAGVAYGKV-KTSTDEVGGSADESKTKTGYA---YGAGVQYNPTDNV 161 Query: 191 SIRGEYRYVACYDQPWDVSKWREK---GDFTAGVVLRF 225 +I Y Y + + GV +F Sbjct: 162 AIDLGYEYSDFGKKDGVDGGYSGDVKTHTVKVGVGYKF 199 >gnl|CDD|144246 pfam00580, UvrD-helicase, UvrD/REP helicase. The Rep family helicases are composed of four structural domains. The Rep family function as dimers. REP helicases catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. Bacillus subtilis addA and Escherichia coli exodeoxyribonuclease V beta have large insertions near to the carboxy-terminus relative to other members of the family. Length = 494 Score = 26.9 bits (60), Expect = 4.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 141 IYGFGGARIRNIMSVES 157 IYGF GA I NI+ E Sbjct: 252 IYGFRGADIENILKFEK 268 >gnl|CDD|33739 COG3958, COG3958, Transketolase, C-terminal subunit [Carbohydrate transport and metabolism]. Length = 312 Score = 26.3 bits (58), Expect = 7.5 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 147 ARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGI-EKKLASM---LSIRGEYRYVACY 202 R + + V AD + ST A F D+ VGI E+ + L++ G+ +V+ + Sbjct: 21 GRKNSDIVVLDADLSSSTKTGYFAKEFPDRFFNVGIAEQDMVGTAAGLALAGKKPFVSTF 80 >gnl|CDD|32659 COG2831, FhaC, Hemolysin activation/secretion protein [Intracellular trafficking and secretion]. Length = 554 Score = 26.1 bits (57), Expect = 7.9 Identities = 24/115 (20%), Positives = 42/115 (36%), Gaps = 7/115 (6%) Query: 16 KIILSGLFL--GFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRL 73 K + G + GF + D G+ + + + YV D+ K+ + S L Sbjct: 445 KFSIGGRYSVRGFDGGSLSGDRGWYLSNELRWPLPPGGALQ-PYVFVDYGKVYNNSAEYL 503 Query: 74 QNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTF 128 +L G +GL G + L + G L G D + + F ++F Sbjct: 504 SGETLAGAGLGLRGNL-KDGFSYDLDL-GRPLSKPAGFDNRRT--VVGFSFSYSF 554 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.140 0.412 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,676,010 Number of extensions: 136426 Number of successful extensions: 338 Number of sequences better than 10.0: 1 Number of HSP's gapped: 338 Number of HSP's successfully gapped: 10 Length of query: 225 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 135 Effective length of database: 4,318,927 Effective search space: 583055145 Effective search space used: 583055145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.5 bits)