Query         gi|254781129|ref|YP_003065542.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 103
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Wed Jun  1 01:43:49 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781129.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2b2a_A Telomerase reverse tran   7.5      95   0.004   13.5   0.6   15   54-68     10-24  (199)
  2 3exc_X Uncharacterized protein   4.4 1.6E+02  0.0068   12.4   0.3   21    7-27     19-39  (91)
  3 1fui_A L-fucose isomerase; ket   4.3 2.2E+02  0.0092   11.7   1.7   27   75-101   451-482 (591)
  4 1vk9_A Conserved hypothetical    3.9      93  0.0039   13.6  -1.3   17   83-99     23-39  (151)
  5 1x9p_A Penton protein; jellyro   3.5 2.3E+02  0.0096   11.6   0.4   20   12-31     39-58  (523)
  6 2w6j_H F1-ATPase delta subunit   3.4   2E+02  0.0086   11.8   0.1   72    3-82      9-86  (168)
  7 2ivy_A Hypothetical protein SS   3.3 2.3E+02  0.0098   11.6   0.3   20    9-28     20-39  (101)
  8 3hiq_A Vacuolar saporin; ribos   3.1 2.2E+02  0.0091   11.7   0.0    9   18-26     45-53  (345)
  9 1ybe_A Naprtase, nicotinate ph   2.9 2.8E+02   0.012   11.2   0.4   33   30-62    405-442 (449)
 10 2au5_A Conserved domain protei   2.8 2.8E+02   0.012   11.2   0.2   10   23-32     40-49  (139)

No 1  
>2b2a_A Telomerase reverse transcriptase; TERT, RT, transferase; 2.22A {Tetrahymena thermophila}
Probab=7.53  E-value=95  Score=13.53  Aligned_cols=15  Identities=53%  Similarity=0.503  Sum_probs=5.7

Q ss_pred             HHHHHHHEEEEEECC
Q ss_conf             552221101001057
Q gi|254781129|r   54 QKINNIILSKAMVFP   68 (103)
Q Consensus        54 qkinniilskamvfp   68 (103)
                      ||||||--.|.|.-.
T Consensus        10 qkinninnnkqmltr   24 (199)
T 2b2a_A           10 QKINNINNNKQMLTR   24 (199)
T ss_dssp             -----------CCBC
T ss_pred             HHHCCCCCHHHHHHH
T ss_conf             885064543777644


No 2  
>3exc_X Uncharacterized protein; ferredoxin fold, double split beta-alpha-beta fold, dimer, catalytic aspartate, RNA'ASE, hydrolase; 2.25A {Sulfolobus solfataricus}
Probab=4.39  E-value=1.6e+02  Score=12.36  Aligned_cols=21  Identities=29%  Similarity=0.384  Sum_probs=14.7

Q ss_pred             HHHHHHCCCCEEEEEEEECCC
Q ss_conf             664310011002366751258
Q gi|254781129|r    7 HKAASNALNFATTQVQYSTFT   27 (103)
Q Consensus         7 hkaasnalnfattqvqystft   27 (103)
                      .|.+.--..|+...||||.|.
T Consensus        19 ~kv~k~L~~yGl~rvQ~SVFe   39 (91)
T 3exc_X           19 NKLANNLKKLGLERIQRSAFE   39 (91)
T ss_dssp             HHHHHHHHHTTCEEEETTEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEEE
T ss_conf             999999997099516865899


No 3  
>1fui_A L-fucose isomerase; ketol isomerase, fucose metabolism, L-fucose to L-fuculose conversion; HET: FOC; 2.50A {Escherichia coli K12} SCOP: b.43.2.1 c.85.1.1
Probab=4.26  E-value=2.2e+02  Score=11.70  Aligned_cols=27  Identities=33%  Similarity=0.376  Sum_probs=20.6

Q ss_pred             HHHCCC-----EEEEEECCCEEEEEECCCHHC
Q ss_conf             552050-----344540463236632332000
Q gi|254781129|r   75 SLKEGV-----ALNLVKDESLSCVIAEGEKLE  101 (103)
Q Consensus        75 slkegv-----alnlvkdeslscviaegekle  101 (103)
                      ..|.|.     .+|++++..+.+.|+||+-++
T Consensus       451 ~tk~G~pvT~~Ri~~v~G~~~~l~IaeG~~V~  482 (591)
T 1fui_A          451 LTEGGVPFTMTRVNIIKGLGPVLQIAEGWSVE  482 (591)
T ss_dssp             BCCTTCEEEEEEEEEETTTEEEEEEEEEEECC
T ss_pred             EECCCCEEEEEEEEEECCCCEEEEEEEEEEEC
T ss_conf             61799869999999967982699997776852


No 4  
>1vk9_A Conserved hypothetical protein TM1506; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; HET: UNL; 2.70A {Thermotoga maritima} SCOP: c.97.1.3
Probab=3.92  E-value=93  Score=13.58  Aligned_cols=17  Identities=18%  Similarity=0.352  Sum_probs=8.9

Q ss_pred             EEEECCCEEEEEECCCH
Q ss_conf             45404632366323320
Q gi|254781129|r   83 NLVKDESLSCVIAEGEK   99 (103)
Q Consensus        83 nlvkdeslscviaegek   99 (103)
                      .|.+.+.+|||+..|+.
T Consensus        23 ~LL~e~~~S~vv~~g~~   39 (151)
T 1vk9_A           23 KIFEKKDLSLLAYSGRS   39 (151)
T ss_dssp             HHHHHTTCSEEEESSSE
T ss_pred             HHHHHCCEEEEEECCCE
T ss_conf             99971883799965999


No 5  
>1x9p_A Penton protein; jellyroll domain, anti-parallel beta sheet, insertion domain, virus like particle; HET: C15; 3.30A {Human adenovirus 2} PDB: 1x9t_A* 2bld_A 2c9f_A 2c9g_A 2c6s_A
Probab=3.51  E-value=2.3e+02  Score=11.60  Aligned_cols=20  Identities=30%  Similarity=0.527  Sum_probs=16.3

Q ss_pred             HCCCCEEEEEEEECCCHHHH
Q ss_conf             00110023667512583450
Q gi|254781129|r   12 NALNFATTQVQYSTFTPEKM   31 (103)
Q Consensus        12 nalnfattqvqystftpekm   31 (103)
                      +.-||.|+-||-+.|+|..-
T Consensus        39 dHSnf~TtViQN~d~tp~eA   58 (523)
T 1x9p_A           39 DHSNFLTTVIQNNDYSPGEA   58 (523)
T ss_dssp             BTTEEEEECCCCTTSCHHHH
T ss_pred             CCCCCEEEEEECCCCCCCCC
T ss_conf             52202024565488880102


No 6  
>2w6j_H F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_H
Probab=3.41  E-value=2e+02  Score=11.84  Aligned_cols=72  Identities=13%  Similarity=0.291  Sum_probs=33.3

Q ss_pred             HHHHHHHHHHCCCCEEEEEEEECC-CHHHHCCCHHHCCCCCHHHHHHCCCCHHHHHHHHEE----EEEECCCHHH-HHHH
Q ss_conf             135566431001100236675125-834501014434788811211025776552221101----0010578123-5655
Q gi|254781129|r    3 RDGLHKAASNALNFATTQVQYSTF-TPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILS----KAMVFPNQSD-IASL   76 (103)
Q Consensus         3 rdglhkaasnalnfattqvqystf-tpekmklsqdylgntnpdavnqlnlddqkinniils----kamvfpnqsd-iasl   76 (103)
                      |-|+.+-.-.+-.||+...-++.+ +|+||+|.-     .-|+.   .-++...+..+++.    .--+.|+..+ |+.|
T Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~kl~l~i-----vtP~~---~v~~~~~V~~V~lp~~eG~~GILp~H~plit~L   80 (168)
T 2w6j_H            9 RPGLGRLVRQVRLYAEAAAAQAPAAGPGQMSFTF-----ASPTQ---VFFNSANVRQVDVPTQTGAFGILAAHVPTLQVL   80 (168)
T ss_dssp             ------------------------------CCCE-----ECSSC---EEEC-----CCBCCC-----------------C
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEE-----ECCCC---EEECCCCEEEEEEECCCCCEEECCCCHHHHHEE
T ss_conf             7135556576304665203257889987479999-----87982---288788479999966945714458876466010


Q ss_pred             HCCCEE
Q ss_conf             205034
Q gi|254781129|r   77 KEGVAL   82 (103)
Q Consensus        77 kegval   82 (103)
                      +.|+.-
T Consensus        81 ~pG~i~   86 (168)
T 2w6j_H           81 RPGLVV   86 (168)
T ss_dssp             CSBCCB
T ss_pred             CCCEEE
T ss_conf             488189


No 7  
>2ivy_A Hypothetical protein SSO1404; structural genomics,unknown function, structural genomics, unknown function, CAS, RNAI, crispr; 1.4A {Sulfolobus solfataricus} SCOP: d.58.58.1 PDB: 2i8e_A
Probab=3.26  E-value=2.3e+02  Score=11.56  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=13.2

Q ss_pred             HHHHCCCCEEEEEEEECCCH
Q ss_conf             43100110023667512583
Q gi|254781129|r    9 AASNALNFATTQVQYSTFTP   28 (103)
Q Consensus         9 aasnalnfattqvqystftp   28 (103)
                      .+.--..|.-+.||||.|.-
T Consensus        20 v~k~L~~yGl~rvQ~SVFe~   39 (101)
T 2ivy_A           20 VAEFLKKKGLDRIQYSVFMG   39 (101)
T ss_dssp             HHHHHHHTTCEEEETTEEEE
T ss_pred             HHHHHHHHCCCCEEEEEEEE
T ss_conf             99999971985305138999


No 8  
>3hiq_A Vacuolar saporin; ribosome inactivating proteins, RIPS, hydrolase, plant defense, protein synthesis inhibitor, toxin; 2.19A {Saponaria officinalis}
Probab=3.14  E-value=2.2e+02  Score=11.72  Aligned_cols=9  Identities=78%  Similarity=1.065  Sum_probs=0.0

Q ss_pred             EEEEEEECC
Q ss_conf             236675125
Q gi|254781129|r   18 TTQVQYSTF   26 (103)
Q Consensus        18 ttqvqystf   26 (103)
                      ||..|||||
T Consensus        45 ~~~~~~~~~   53 (345)
T 3hiq_A           45 TTKAQYSTF   53 (345)
T ss_dssp             ---------
T ss_pred             CCHHHHHHH
T ss_conf             408889999


No 9  
>1ybe_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens} SCOP: c.1.17.2 d.41.2.2
Probab=2.92  E-value=2.8e+02  Score=11.16  Aligned_cols=33  Identities=21%  Similarity=0.263  Sum_probs=0.0

Q ss_pred             HHCCCHHHCCCCCHHHH-----HHCCCCHHHHHHHHEE
Q ss_conf             50101443478881121-----1025776552221101
Q gi|254781129|r   30 KMKLSQDYLGNTNPDAV-----NQLNLDDQKINNIILS   62 (103)
Q Consensus        30 kmklsqdylgntnpdav-----nqlnlddqkinniils   62 (103)
                      +||+|++---+|-|+..     ..+...+|....++++
T Consensus       405 ~~KlSd~~gK~tg~~~~~~~~~r~~g~~~~~~~~~~~~  442 (449)
T 1ybe_A          405 AVKLSDNPQKATGDPAEVERYLKFFGEEDHKEQKVLVE  442 (449)
T ss_dssp             CCBCCSSGGGCBSCHHHHHHHHHHHCCCC---------
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEE
T ss_conf             46724898876699899999999837676423137985


No 10 
>2au5_A Conserved domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Enterococcus faecalis V583} SCOP: a.244.1.1
Probab=2.78  E-value=2.8e+02  Score=11.18  Aligned_cols=10  Identities=30%  Similarity=0.511  Sum_probs=0.0

Q ss_pred             EECCCHHHHC
Q ss_conf             5125834501
Q gi|254781129|r   23 YSTFTPEKMK   32 (103)
Q Consensus        23 ystftpekmk   32 (103)
                      ||+|.|+-.+
T Consensus        40 ~S~F~P~VL~   49