RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781129|ref|YP_003065542.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >gnl|CDD|34517 COG4908, COG4908, Uncharacterized protein containing a NRPS condensation (elongation) domain [General function prediction only]. Length = 439 Score = 29.5 bits (66), Expect = 0.21 Identities = 17/49 (34%), Positives = 27/49 (55%) Query: 51 LDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEK 99 DD KIN+ L + F ++ +I LK+ + ++ LSC +EGEK Sbjct: 17 ADDYKINDHTLHYVITFGDKFNIDRLKKALRYSVKAVPILSCKFSEGEK 65 >gnl|CDD|36206 KOG0988, KOG0988, KOG0988, RNA-directed RNA polymerase QDE-1 required for posttranscriptional gene silencing and RNA interference [RNA processing and modification]. Length = 1145 Score = 24.6 bits (53), Expect = 6.4 Identities = 10/37 (27%), Positives = 16/37 (43%) Query: 5 GLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNT 41 L K S A++F + S EK + D++ T Sbjct: 903 ELAKKHSQAVDFPKSGADESMPEKEKPERYPDFMEKT 939 >gnl|CDD|147633 pfam05559, DUF763, Protein of unknown function (DUF763). This family consists of several uncharacterized bacterial and archaeal proteins of unknown function. Length = 319 Score = 24.1 bits (53), Expect = 8.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 73 IASLKEGVALNLVKDES 89 I+ ++G LNLV ES Sbjct: 185 ISGRRQGEVLNLVDKES 201 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.310 0.127 0.338 Gapped Lambda K H 0.267 0.0752 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,055,339 Number of extensions: 43868 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 8 Length of query: 103 Length of database: 6,263,737 Length adjustment: 70 Effective length of query: 33 Effective length of database: 4,751,107 Effective search space: 156786531 Effective search space used: 156786531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (23.4 bits)