RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781129|ref|YP_003065542.1| hypothetical protein
CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62]
         (103 letters)



>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase,
           translation termination, ATP-binding, cytoplasm,
           hydrolase, membrane; 2.80A {Schizosaccharomyces pombe}
           (A:1-326)
          Length = 326

 Score = 25.9 bits (56), Expect = 1.7
 Identities = 6/32 (18%), Positives = 15/32 (46%), Gaps = 5/32 (15%)

Query: 25  TFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKI 56
           TF+    K ++ +    N    N++ L  +++
Sbjct: 300 TFSERVEKYAERFA--PNA---NEIRLKTEEL 326


>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix,
           helix-turn-helix, ATP binding, Zn(2+) binding,
           hydrolase; 1.80A {Escherichia coli} (A:1-209)
          Length = 209

 Score = 25.4 bits (54), Expect = 2.8
 Identities = 4/19 (21%), Positives = 6/19 (31%)

Query: 25  TFTPEKMKLSQDYLGNTNP 43
           T      +     LG  +P
Sbjct: 183 TADDTTRQDIVRLLGLNDP 201


>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}
           (A:1-189,A:307-346)
          Length = 229

 Score = 24.6 bits (52), Expect = 5.1
 Identities = 11/36 (30%), Positives = 19/36 (52%)

Query: 2   LRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDY 37
           L + +++   +ALN  T +V  S   PE + L+  Y
Sbjct: 187 LLEDVNQLIEDALNVKTFKVLMSGTLPESLTLTNSY 222


>1rz4_A Eukaryotic translation initiation factor 3 subunit 11; heat
           analogous motif, winged-helix, biosynthetic protein;
           2.10A {Homo sapiens} (A:1-127,A:199-226)
          Length = 155

 Score = 24.1 bits (52), Expect = 6.3
 Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 2/57 (3%)

Query: 48  QLNLDDQKINNI--ILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEK 102
           Q N    +      IL KA+     +D    K  +     ++  +  ++  G+ LE 
Sbjct: 55  QFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCXIDQAHQEERPIRQILYLGDLLET 111


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.310    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0499    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 645,435
Number of extensions: 22464
Number of successful extensions: 30
Number of sequences better than 10.0: 1
Number of HSP's gapped: 30
Number of HSP's successfully gapped: 4
Length of query: 103
Length of database: 4,956,049
Length adjustment: 61
Effective length of query: 42
Effective length of database: 2,893,944
Effective search space: 121545648
Effective search space used: 121545648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 50 (23.6 bits)