BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781129|ref|YP_003065542.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781129|ref|YP_003065542.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 210 bits (535), Expect = 4e-57, Method: Compositional matrix adjust. Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII 60 MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII Sbjct: 1 MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII 60 Query: 61 LSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE 103 LSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE Sbjct: 61 LSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE 103 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 20.4 bits (41), Expect = 8.3, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 23/37 (62%) Query: 55 KINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLS 91 +++ IIL + + + + I ++ G L+L+K+ ++S Sbjct: 751 RLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNIS 787 >gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 20.4 bits (41), Expect = 8.5, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Query: 78 EGVALNLVKDESLSCVIAEGEK 99 EG+A+NL KD S VI G + Sbjct: 77 EGLAVNLAKDISAQ-VIVRGLR 97 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.310 0.127 0.338 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,957 Number of Sequences: 1233 Number of extensions: 2128 Number of successful extensions: 7 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 103 length of database: 328,796 effective HSP length: 62 effective length of query: 41 effective length of database: 252,350 effective search space: 10346350 effective search space used: 10346350 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.9 bits) S2: 32 (16.9 bits)