RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62] (150 letters) >gnl|CDD|173305 PRK14844, PRK14844, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional. Length = 2836 Score = 26.5 bits (58), Expect = 2.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Query: 95 LSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQI 140 L D V++I + ++ KIR E + G+ S+ YGR G+I Sbjct: 2284 LIDEDKVKQINIAGLDVVKIRSPLTCEISPGVCSLCYGRDLATGKI 2329 >gnl|CDD|181708 PRK09222, PRK09222, isocitrate dehydrogenase; Validated. Length = 482 Score = 26.4 bits (59), Expect = 2.9 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Query: 45 IYQNQLSERKEGKKEFYDAV--NMGYQ 69 IY +S++K G KEF +AV N+G + Sbjct: 318 IYNEGVSKKKVGTKEFAEAVIENLGQK 344 >gnl|CDD|177271 PHA00360, II, replication initiation protein. Length = 421 Score = 25.8 bits (56), Expect = 4.6 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Query: 27 LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66 L +P P YAGIA I+ EG K F V + Sbjct: 61 LKHPFESLPSHYAGIAFKIF--------EGGKNFEPCVEI 92 >gnl|CDD|181403 PRK08367, porA, pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed. Length = 394 Score = 25.6 bits (56), Expect = 5.6 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 13/71 (18%) Query: 9 HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY------- 61 HE+L + + +P + +++ N API+ N +Q+ +S+R G +FY Sbjct: 89 HEVLFIAAGMRLP-IVMAIGNRALSAPIN----IWNDWQDTISQRDTGWMQFYAENNQEA 143 Query: 62 -DAVNMGYQLA 71 D + + +++A Sbjct: 144 LDLILIAFKVA 154 >gnl|CDD|177394 PHA02562, 46, endonuclease subunit; Provisional. Length = 562 Score = 25.4 bits (56), Expect = 5.9 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 104 IGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145 I V++ E+ K+ D + E NQ I+++D QI+T K Sbjct: 162 ISVLS-EMDKLNKDKIRELNQQIQTLDMKIDHIQQQIKTYNK 202 >gnl|CDD|180124 PRK05537, PRK05537, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated. Length = 568 Score = 25.0 bits (55), Expect = 8.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 99 KNVQRIGVIAQEISK 113 N+ RIG +A EI+K Sbjct: 449 LNILRIGFVASEITK 463 >gnl|CDD|179666 PRK03881, PRK03881, hypothetical protein; Provisional. Length = 467 Score = 24.8 bits (55), Expect = 9.6 Identities = 5/14 (35%), Positives = 12/14 (85%) Query: 107 IAQEISKIRPDTVV 120 +A+ I++ +PDT++ Sbjct: 37 LARRIAEKKPDTII 50 >gnl|CDD|163075 TIGR02924, ICDH_alpha, isocitrate dehydrogenase. This family of mainly alphaproteobacterial enzymes is a member of the isocitrate/isopropylmalate dehydrogenase superfamily described by pfam00180. Every member of the seed of this model appears to have a TCA cycle lacking only a determined isocitrate dehydrogenase. The precise identity of the cofactor (NADH -- 1.1.1.41 vs. NADPH -- 1.1.1.42) is unclear. Length = 473 Score = 24.7 bits (54), Expect = 9.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 44 NIYQNQLSERKEGKKEFYDAV 64 +IY + S++K G KEF +AV Sbjct: 313 DIYNEKTSKQKVGTKEFAEAV 333 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.133 0.371 Gapped Lambda K H 0.267 0.0660 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,408,825 Number of extensions: 141455 Number of successful extensions: 225 Number of sequences better than 10.0: 1 Number of HSP's gapped: 225 Number of HSP's successfully gapped: 13 Length of query: 150 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 65 Effective length of database: 4,157,793 Effective search space: 270256545 Effective search space used: 270256545 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.3 bits)