RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62] (150 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 34.1 bits (78), Expect = 0.013 Identities = 26/171 (15%), Positives = 45/171 (26%), Gaps = 64/171 (37%) Query: 2 DQKQQAFHEILSL---------MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSE 52 K F ++L+L ++ + L L L + Sbjct: 74 PSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTT---------------LVK 118 Query: 53 RKEGKKEFYDAVNMGYQ---------LAPLVSDRRMKCNVKPVA---------------- 87 KE K + A M + L V + N + VA Sbjct: 119 TKELIKNYITARIMAKRPFDKKSNSALFRAVGEG----NAQLVAIFGGQGNTDDYFEELR 174 Query: 88 NLYQ-YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137 +LYQ Y L ++ E+ + + V + + NI Sbjct: 175 DLYQTYHVLVGDL-IKFSAETLSELIR-TTLDA-------EKV-FTQGLNI 215 >3gud_A NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1} Length = 129 Score = 27.3 bits (60), Expect = 1.5 Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 15/65 (23%) Query: 75 SDRRMKCNVKPVANL----------YQYRYLS-----DPKNVQRIGVIAQEISKIRPDTV 119 SD R K ++ P+++ YQY++ + GVIAQ+I K+ D Sbjct: 1 SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEG 60 Query: 120 VENNQ 124 + Sbjct: 61 LSAFD 65 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 26.9 bits (58), Expect = 1.9 Identities = 7/25 (28%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Query: 4 KQQAFHEI---LSLMQNVTVPKLPI 25 ++QA ++ L L + + P L I Sbjct: 18 EKQALKKLQASLKLYADDSAPALAI 42 >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Length = 236 Score = 26.6 bits (58), Expect = 2.4 Identities = 8/37 (21%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Query: 87 ANLYQYRYLSDP--KNVQRIGVIAQEISKIRPDTVVE 121 ++ Y++ K+ V + ++RP T+VE Sbjct: 51 SDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVE 87 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.316 0.133 0.371 Gapped Lambda K H 0.267 0.0532 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,209,739 Number of extensions: 50693 Number of successful extensions: 78 Number of sequences better than 10.0: 1 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 7 Length of query: 150 Length of database: 5,693,230 Length adjustment: 84 Effective length of query: 66 Effective length of database: 3,656,734 Effective search space: 241344444 Effective search space used: 241344444 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.3 bits)