RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781133|ref|YP_003065546.1| hypothetical protein CLIBASIA_05175 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >gnl|CDD|35420 KOG0199, KOG0199, KOG0199, ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]. Length = 1039 Score = 28.1 bits (62), Expect = 1.1 Identities = 22/96 (22%), Positives = 36/96 (37%), Gaps = 22/96 (22%) Query: 64 RVIELSGASDCKSWLSRSVLKEIYSY---PWNQLCCQAVIHRIPDEDYPQHRMLTSLGGI 120 R + S ASD W+ + E+++Y PW ++ I Sbjct: 288 RHRKFSHASD--VWMYGVTIWEMFTYGEEPWVGCRGIQILKNIDA--------------- 330 Query: 121 RYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVH 156 R+PR + +E+IY I W HN +R + Sbjct: 331 GERLPR--PKYCSEDIYQIMKNCWAHNPADRPTFSA 364 >gnl|CDD|99976 cd03804, GT1_wbaZ_like, This family is most closely related to the GT1 family of glycosyltransferases. wbaZ in Salmonella enterica has been shown to possess the mannosyl transferase activity. The members of this family are found in certain bacteria and Archaea.. Length = 351 Score = 26.7 bits (60), Expect = 2.9 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Query: 13 AKPRINQIIA--DFVAKRIKDCSSGWDR 38 + R++ IA FVA+RIK + R Sbjct: 150 SAARVDYFIANSRFVARRIKKY---YGR 174 >gnl|CDD|177012 CHL00073, chlN, photochlorophyllide reductase subunit N. Length = 457 Score = 26.1 bits (58), Expect = 4.6 Identities = 9/23 (39%), Positives = 11/23 (47%), Gaps = 10/23 (43%) Query: 56 YHNYCPISRVIELSGASDCKSWL 78 YH +CPIS C +WL Sbjct: 18 YHTFCPIS----------CVAWL 30 >gnl|CDD|38741 KOG3533, KOG3533, KOG3533, Inositol 1,4,5-trisphosphate receptor [Signal transduction mechanisms]. Length = 2706 Score = 25.3 bits (55), Expect = 8.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 130 RNAAENIYVITHEAWMHNK 148 R NIY++ H+ HNK Sbjct: 2128 REVGHNIYILAHQLARHNK 2146 >gnl|CDD|110369 pfam01364, Peptidase_C25, Peptidase family C25. Length = 349 Score = 25.0 bits (54), Expect = 9.6 Identities = 11/42 (26%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Query: 2 YNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMG 43 N I+ T+GG + V K KD D + G Sbjct: 303 PNNIKRTFGGV----TMNGMFAMVEKYKKDGEHMLDTWTVFG 340 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.137 0.442 Gapped Lambda K H 0.267 0.0550 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,058,955 Number of extensions: 102157 Number of successful extensions: 256 Number of sequences better than 10.0: 1 Number of HSP's gapped: 256 Number of HSP's successfully gapped: 6 Length of query: 159 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 73 Effective length of database: 4,405,363 Effective search space: 321591499 Effective search space used: 321591499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 53 (24.6 bits)