RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781133|ref|YP_003065546.1| hypothetical protein CLIBASIA_05175 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >gnl|CDD|182801 PRK10876, recB, exonuclease V subunit beta; Provisional. Length = 1181 Score = 28.4 bits (64), Expect = 0.86 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Query: 101 HRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAE 134 HR+ D DY +H GG+ Y LRG + Sbjct: 1124 HRLADYDYQRH-----FGGVIYLF--LRGVDKEH 1150 >gnl|CDD|178448 PLN02857, PLN02857, octaprenyl-diphosphate synthase. Length = 416 Score = 28.3 bits (63), Expect = 1.0 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 22/80 (27%) Query: 17 INQIIADFVAKRIKDCSSGWDRFVSMG--ILKSNFLVAGIIYHNYCPISRVIELSGASDC 74 I+Q+I DF + IK SS +D V++ +LKS + A +I A+ Sbjct: 232 ISQVIKDFASGEIKQASSLFDCDVTLDEYLLKSYYKTASLI---------------AAST 276 Query: 75 K-----SWLSRSVLKEIYSY 89 K S + SV +++Y Y Sbjct: 277 KSAAIFSGVDSSVKEQMYEY 296 >gnl|CDD|152369 pfam11934, DUF3452, Domain of unknown function (DUF3452). This presumed domain is functionally uncharacterized. This domain is found in bacteria and eukaryotes. This domain is typically between 124 to 150 amino acids in length. This domain is found associated with pfam01858, pfam01857. This domain has a single completely conserved residue W that may be functionally important. Length = 138 Score = 28.1 bits (63), Expect = 1.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Query: 45 LKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPW 91 L+ NF+V ++Y Y I R I L + S S +++ + W Sbjct: 58 LERNFVVLSVLYKKYKRIFREIFLEPPEEPPSRSSPCSSSDLFRFGW 104 >gnl|CDD|184626 PRK14329, PRK14329, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional. Length = 467 Score = 27.3 bits (61), Expect = 1.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 15 PRINQIIADFVAKRIKDCSSG 35 P+ N I DFV RI DC+S Sbjct: 438 PKENYKIGDFVNVRITDCTSA 458 >gnl|CDD|162688 TIGR02079, THD1, threonine dehydratase. This model represents threonine dehydratase, the first step in the pathway converting threonine into isoleucine. At least two other clades of biosynthetic threonine dehydratases have been characterized by models TIGR01124 and TIGR01127. Those sequences described by this model are exclusively found in species containg the rest of the isoleucine pathway and which are generally lacking in members of the those other two clades of threonine dehydratases. Members of this clade are also often gene clustered with other elements of the isoleucine pathway. Length = 409 Score = 27.0 bits (60), Expect = 2.3 Identities = 10/46 (21%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Query: 44 ILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSY 89 I + + ++ H P+ LS +L R L+ + SY Sbjct: 3 IEAARKRLKEVVPHT--PLQLNERLSEKYGANIYLKREDLQPVRSY 46 >gnl|CDD|177916 PLN02277, PLN02277, H(+) -translocating inorganic pyrophosphatase. Length = 730 Score = 26.3 bits (58), Expect = 3.9 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query: 15 PRINQIIADFVAKRIKDCS-SGWDRFVSM 42 PR +IAD V + DC+ G D F S+ Sbjct: 222 PRNPAVIADLVGDNVGDCAARGADLFESI 250 >gnl|CDD|161679 TIGR00045, TIGR00045, glycerate kinase. The only characterized member of this family so far is the glycerate kinase GlxK (EC 2.7.1.31) of E. coli. This enzyme acts after glyoxylate carboligase and 2-hydroxy-3-oxopropionate reductase (tartronate semialdehyde reductase) in the conversion of glyoxylate to 3-phosphoglycerate (the D-glycerate pathway) as a part of allantoin degradation. Length = 375 Score = 26.1 bits (58), Expect = 3.9 Identities = 8/27 (29%), Positives = 12/27 (44%) Query: 6 EITWGGNAKPRINQIIADFVAKRIKDC 32 E+ GG A + I + R+KD Sbjct: 159 ELGPGGGALAELASIDLSNLDPRLKDV 185 >gnl|CDD|162708 TIGR02109, PQQ_syn_pqqE, coenzyme PQQ biosynthesis protein E. This model describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. Length = 358 Score = 25.8 bits (57), Expect = 5.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 13 AKPRINQIIADFVAKRIKDCSSGWDR 38 I+ ++ D+ A+R K C GW R Sbjct: 218 GGLVIDYVVPDYYAERPKACMGGWGR 243 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.137 0.442 Gapped Lambda K H 0.267 0.0674 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,630,063 Number of extensions: 155316 Number of successful extensions: 346 Number of sequences better than 10.0: 1 Number of HSP's gapped: 346 Number of HSP's successfully gapped: 10 Length of query: 159 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 73 Effective length of database: 4,136,185 Effective search space: 301941505 Effective search space used: 301941505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 53 (24.3 bits)