BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781133|ref|YP_003065546.1| hypothetical protein CLIBASIA_05175 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781133|ref|YP_003065546.1| hypothetical protein CLIBASIA_05175 [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 331 bits (849), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 159/159 (100%), Positives = 159/159 (100%) Query: 1 MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYC 60 MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYC Sbjct: 1 MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYC 60 Query: 61 PISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGI 120 PISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGI Sbjct: 61 PISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGI 120 Query: 121 RYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL 159 RYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL Sbjct: 121 RYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL 159 >gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 24.3 bits (51), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Query: 96 CQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRN 131 QA+ ++P E+YP+ L +G +R +L G N Sbjct: 142 SQAIFQKMPLEEYPR---LQKIGINYFRDFKLLGTN 174 >gi|254780170|ref|YP_003064583.1| cationic amino acid ABC transporter, periplasmic binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 342 Score = 23.5 bits (49), Expect = 1.8, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 13/22 (59%) Query: 53 GIIYHNYCPISRVIELSGASDC 74 G I H IS V +LSGAS C Sbjct: 128 GFIMHKKKGISSVSQLSGASIC 149 >gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Score = 21.9 bits (45), Expect = 5.1, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 36 WDRFVSMGILKSNFLVAGIIYHN 58 ++RF+ + K++ + AG IY N Sbjct: 75 YERFMGISTAKADNITAGRIYKN 97 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 21.9 bits (45), Expect = 5.7, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 3 NTIE-ITWGGNAKPRINQIIADFVAKR 28 N IE I WG + P + +++ FVA + Sbjct: 1055 NKIEKIQWGDDMPPGVLRVVKVFVAMK 1081 >gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62] Length = 281 Score = 21.6 bits (44), Expect = 7.0, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Query: 25 VAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASD 73 +A + +CS W F + +F V I H Y I R++ ++GA D Sbjct: 30 IASVLNECSFDWQDFECRELPLGDFCVLRSILHQY-NIGRIV-VAGAID 76 >gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 957 Score = 21.6 bits (44), Expect = 7.3, Method: Compositional matrix adjust. Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 12/71 (16%) Query: 18 NQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSW 77 NQ+I+ + ++ ++ W +++ +S +YCP + +G ++ K+ Sbjct: 514 NQVIS---KQELQSLANNWHKYLEAEYKES---------ESYCPEKLGLLHNGENERKNS 561 Query: 78 LSRSVLKEIYS 88 +S+ +LK+I S Sbjct: 562 VSKEILKKIGS 572 >gi|254780328|ref|YP_003064741.1| UDP-glucose 4-epimerase [Candidatus Liberibacter asiaticus str. psy62] Length = 333 Score = 21.2 bits (43), Expect = 9.6, Method: Compositional matrix adjust. Identities = 9/19 (47%), Positives = 11/19 (57%) Query: 137 YVITHEAWMHNKINRQSSV 155 YV+ E HNK+N SV Sbjct: 148 YVVERELLQHNKVNGLRSV 166 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.137 0.442 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,661 Number of Sequences: 1233 Number of extensions: 3676 Number of successful extensions: 11 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 9 length of query: 159 length of database: 328,796 effective HSP length: 67 effective length of query: 92 effective length of database: 246,185 effective search space: 22649020 effective search space used: 22649020 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 35 (18.1 bits)