RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781135|ref|YP_003065548.1| hypothetical protein CLIBASIA_05185 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >2hd5_A Ubiquitin carboxyl-terminal hydrolase 2; deubiquitinating protease, cysteine protease, substrate enzyme complex, hydrolase; 1.85A {Homo sapiens} (A:1-125,A:240-359) Length = 245 Score = 24.9 bits (53), Expect = 4.2 Identities = 10/57 (17%), Positives = 18/57 (31%) Query: 17 TFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDS 73 F + E N N+ +L + Y +Y +W+ +DS Sbjct: 149 NFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDS 205 >1nm8_A Carnitine O-acetyltransferase; two equally sized domains, anti-parallel beta-strand; 1.60A {Homo sapiens} (A:92-385) Length = 294 Score = 23.9 bits (51), Expect = 7.7 Identities = 6/72 (8%), Positives = 18/72 (25%), Gaps = 6/72 (8%) Query: 1 MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGW 60 + QY + + QD ++ + + ++ +F Sbjct: 51 LGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQ------FFELDV 104 Query: 61 FFKNRQWYIASD 72 + + A Sbjct: 105 YHSDGTPLTADQ 116 >1nun_A Fibroblast growth factor-10; beta-trefoil fold, immunoglobulin-like domain, hormone/growth factor/membrane protein complex; HET: 15P; 2.90A {Homo sapiens} (A:) Length = 145 Score = 23.7 bits (51), Expect = 9.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 54 VYFSYGWFFKNRQWYIA 70 Y S+ W RQ Y+A Sbjct: 100 TYASFNWQHNGRQMYVA 116 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.135 0.461 Gapped Lambda K H 0.267 0.0375 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 682,479 Number of extensions: 24730 Number of successful extensions: 67 Number of sequences better than 10.0: 1 Number of HSP's gapped: 67 Number of HSP's successfully gapped: 8 Length of query: 83 Length of database: 4,956,049 Length adjustment: 47 Effective length of query: 36 Effective length of database: 3,367,214 Effective search space: 121219704 Effective search space used: 121219704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (24.0 bits)