RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781135|ref|YP_003065548.1| hypothetical protein CLIBASIA_05185 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >1nun_A Fibroblast growth factor-10; beta-trefoil fold, immunoglobulin-like domain, hormone/growth factor/membrane protein complex; HET: 15P; 2.90A {Homo sapiens} SCOP: b.42.1.1 Length = 145 Score = 24.8 bits (54), Expect = 5.7 Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 54 VYFSYGWFFKNRQWYIA 70 Y S+ W RQ Y+A Sbjct: 100 TYASFNWQHNGRQMYVA 116 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 24.1 bits (52), Expect = 6.9 Identities = 19/126 (15%), Positives = 27/126 (21%), Gaps = 83/126 (65%) Query: 6 WVTFQYTTPDKTFLIALNGQDERQIYNGNNCKS---SLLPIIC----------------- 45 W+ TPDK +L+ S S P+I Sbjct: 218 WLENPSNTPDKDYLL-----------------SIPIS-CPLIGVIQLAHYVVTAKLLGFT 259 Query: 46 -----------AGHNQNNPVYFSYG------------W--FFKNRQW------YIASDSM 74 GH+Q G W FF + + +I Sbjct: 260 PGELRSYLKGATGHSQ--------GLVTAVAIAETDSWESFFVSVRKAITVLFFI----- 306 Query: 75 DAWTCQ 80 C Sbjct: 307 -GVRCY 311 >2gl6_A Creatine kinase; non-protein kinase, ADP, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP; 2.30A {Homo sapiens} PDB: 1crk_A 1qk1_A Length = 392 Score = 24.1 bits (52), Expect = 7.4 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 11 YTTPDKTFLIALNGQDERQI---YNGNNCKSSLLPIICAGHNQNNPVYFSYGWFF 62 + DKTFLI +N +D ++ G N K + C G + + GW F Sbjct: 228 WHNYDKTFLIWINEEDHTRVISMEKGGNMK-RVFERFCRGLKEVERLIQERGWEF 281 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.135 0.461 Gapped Lambda K H 0.267 0.0411 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 761,668 Number of extensions: 27590 Number of successful extensions: 82 Number of sequences better than 10.0: 1 Number of HSP's gapped: 82 Number of HSP's successfully gapped: 9 Length of query: 83 Length of database: 5,693,230 Length adjustment: 51 Effective length of query: 32 Effective length of database: 4,456,786 Effective search space: 142617152 Effective search space used: 142617152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)