Query         gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 114
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 39220
Date          Mon May 30 05:08:31 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781136.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 pfam10611 DUF2469 Protein of u  31.1      29 0.00075   16.7   1.7   30   72-101    23-52  (101)
  2 pfam03281 Mab-21 Mab-21 protei  28.1     8.9 0.00023   19.7  -1.4   13   20-32     68-80  (360)
  3 TIGR02198 rfaE_dom_I rfaE bifu  23.9      53  0.0013   15.2   1.9   21   83-103   252-272 (321)
  4 KOG1110 consensus               22.9      59  0.0015   14.9   2.0   25   79-103    66-91  (183)
  5 KOG3720 consensus               18.3      84  0.0021   14.0   3.4   52    1-55     82-134 (411)
  6 PRK05687 fliH flagellar assemb  16.0      70  0.0018   14.5   1.1   45   28-76    182-229 (252)
  7 cd00716 creatine_kinase_like P  15.2      59  0.0015   14.9   0.6   41   14-58    152-204 (357)
  8 pfam00341 PDGF Platelet-derive  13.6      83  0.0021   14.0   1.0   17   15-31     10-26  (84)
  9 PRK13386 fliH flagellar assemb  12.8 1.2E+02   0.003   13.1   2.0   45   27-76    167-212 (236)
 10 PRK10125 predicted glycosyl tr  12.5      58  0.0015   15.0  -0.1   21   44-64    132-152 (405)

No 1  
>pfam10611 DUF2469 Protein of unknown function (DUF2469). Member proteins often found in Actinomycetes clustered with signal peptidase and/or RNAse-HII.
Probab=31.13  E-value=29  Score=16.67  Aligned_cols=30  Identities=27%  Similarity=0.493  Sum_probs=23.7

Q ss_pred             CEEEEEEECCCCEEEEEEECCCEEEEECCC
Q ss_conf             444344204554027886246066651242
Q gi|254781136|r   72 SIISAFSYRSSTQQRVFLANHREIYDVTDA  101 (114)
Q Consensus        72 siisafsyrsstqqrvflanhreiydvtda  101 (114)
                      .+++-|+|--.|..|.+|||+-++--.++.
T Consensus        23 DVv~~F~YvVETeRRFYLaN~Vd~~~~~~~   52 (101)
T pfam10611        23 DVVGLFSYVVETERRFYLANSVDLQVRSAG   52 (101)
T ss_pred             HHHHHEEEEEEEEEEEEEECCEEEEEECCC
T ss_conf             988647458984036776052489996289


No 2  
>pfam03281 Mab-21 Mab-21 protein.
Probab=28.05  E-value=8.9  Score=19.70  Aligned_cols=13  Identities=8%  Similarity=-0.077  Sum_probs=4.8

Q ss_pred             ECCCCCCEEEECC
Q ss_conf             1256763687223
Q gi|254781136|r   20 ISSKDQNFLYFPT   32 (114)
Q Consensus        20 isskdqnflyfpt   32 (114)
                      |+|-++--+-+|-
T Consensus        68 V~sP~eF~V~l~L   80 (360)
T pfam03281        68 VISPTEFEIVLYL   80 (360)
T ss_pred             EECCCCEEEEEEE
T ss_conf             8468706999995


No 3  
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I; InterPro: IPR011913    RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in Escherichia coli, and separate proteins in some other genome. The longer, N-terminal domain I (this family) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (IPR011914 from INTERPRO) adds ADP to yield ADP-D-glycero-D-manno-heptose .; GO: 0016773 phosphotransferase activity alcohol group as acceptor, 0016779 nucleotidyltransferase activity, 0005975 carbohydrate metabolic process.
Probab=23.94  E-value=53  Score=15.17  Aligned_cols=21  Identities=38%  Similarity=0.480  Sum_probs=14.6

Q ss_pred             CEEEEEEECCCEEEEECCCCC
Q ss_conf             402788624606665124222
Q gi|254781136|r   83 TQQRVFLANHREIYDVTDASS  103 (114)
Q Consensus        83 tqqrvflanhreiydvtdass  103 (114)
                      .+-.-+-|--||.||||-|.-
T Consensus       252 ~~~~H~Pa~A~EVyDVTGAGD  272 (321)
T TIGR02198       252 GEPIHIPAQAREVYDVTGAGD  272 (321)
T ss_pred             CCEEEECCCCEEEEEECCCCH
T ss_conf             962660354102333338745


No 4  
>KOG1110 consensus
Probab=22.93  E-value=59  Score=14.89  Aligned_cols=25  Identities=32%  Similarity=0.579  Sum_probs=19.7

Q ss_pred             ECCCC-EEEEEEECCCEEEEECCCCC
Q ss_conf             04554-02788624606665124222
Q gi|254781136|r   79 YRSST-QQRVFLANHREIYDVTDASS  103 (114)
Q Consensus        79 yrsst-qqrvflanhreiydvtdass  103 (114)
                      |-.+. .+++++|-.-.|||||-...
T Consensus        66 ydGs~~d~~Il~AI~G~VYDVT~Gr~   91 (183)
T KOG1110          66 YDGSDPDKPILLAINGKVYDVTRGRE   91 (183)
T ss_pred             CCCCCCCCCEEEEECCEEEEECCCCC
T ss_conf             47989887248986366888547762


No 5  
>KOG3720 consensus
Probab=18.33  E-value=84  Score=14.00  Aligned_cols=52  Identities=25%  Similarity=0.402  Sum_probs=39.5

Q ss_pred             CCHHHHHHCCCCCC-CCCCEECCCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             90455531145667-55202125676368722317787787899987536566685
Q gi|254781136|r    1 MSQFLRNQYFDSNN-LSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGP   55 (114)
Q Consensus         1 msqflrnqyfdsnn-lsgeyisskdqnflyfptekqqlqenafsilhnfwpttkgp   55 (114)
                      +.+|||+.|.+..| |+..|-   -+....--|....-.+-|.+.+-...|...++
T Consensus        82 LG~~LR~rYvr~~~fL~~~y~---~~ev~iRStd~nRtl~SAqs~laGlfp~~~~~  134 (411)
T KOG3720          82 LGRFLRKRYVRYGNFLSPKYN---PKEVYIRSTDVNRTLMSAQSVLAGLFPPEGRK  134 (411)
T ss_pred             HHHHHHHHHHHCCCCCCCCCC---HHHEEEECCCCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             999999876122355875448---42468863682289999999997417997776


No 6  
>PRK05687 fliH flagellar assembly protein H; Validated
Probab=15.98  E-value=70  Score=14.46  Aligned_cols=45  Identities=22%  Similarity=0.462  Sum_probs=22.8

Q ss_pred             EEECCCHHHHHHHHHH--HHHHHCCCCCC-CEECCCCEEEEEEECCCCEEEE
Q ss_conf             8722317787787899--98753656668-5220554035775088644434
Q gi|254781136|r   28 LYFPTEKQQLQENAFS--ILHNFWPTTKG-PIMRGGCRKICTLDSNSSIISA   76 (114)
Q Consensus        28 lyfptekqqlqenafs--ilhnfwpttkg-pimrggcrkictldsnssiisa   76 (114)
                      |+.-.+.-.+-+..++  +-.+-|.-..- -|.|||||    +.+..|.|.+
T Consensus       182 l~lhPdD~~~V~~~l~~el~~~~W~l~~D~~l~~GGC~----iet~~s~vDa  229 (252)
T PRK05687        182 LRVNPDDLELVEALLGAELSEHGWRLLADPSLHRGGCR----ISAAEGDVDA  229 (252)
T ss_pred             EEECHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCEE----EEECCCEEEC
T ss_conf             99888899999998767776358368637875888869----9878953642


No 7  
>cd00716 creatine_kinase_like Phosphagen (guanidino) kinases such as creatine kinase and similar enzymes. Eukaryotic creatine kinase-like phosphagen (guanidino) kinases are enzymes that transphosphorylate a high energy phosphoguanidino compound, like phosphocreatine (PCr) in the case of creatine kinase (CK), which is used as an energy-storage and -transport metabolite, to ADP, thereby creating ATP. The substrate binding site is located in the cleft between the N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain. In higher eukaryotes, CKs are found as tissue-specific (muscle, brain), as well as compartment-specific (mitochondrial, cytosolic, and flagellar) isoforms. Mitochondrial and cytoplasmic CKs are dimeric or octameric, while the flagellar isoforms are trimers with three CD domains fused as a single protein chain. CKs are either coupled to glycolysis (cytosolic form) or oxidative phosphorylation (mitochondrial form). Besides CK, one
Probab=15.15  E-value=59  Score=14.91  Aligned_cols=41  Identities=32%  Similarity=0.507  Sum_probs=23.7

Q ss_pred             CCCCCEECCCCCCEEEECCCHHHHHHHHH------------HHHHHHCCCCCCCEEC
Q ss_conf             75520212567636872231778778789------------9987536566685220
Q gi|254781136|r   14 NLSGEYISSKDQNFLYFPTEKQQLQENAF------------SILHNFWPTTKGPIMR   58 (114)
Q Consensus        14 nlsgeyisskdqnflyfptekqqlqenaf------------silhnfwpttkgpimr   58 (114)
                      .|.|.|.+-.+-    -+.++|||.+.-|            +-....||.-.|-..-
T Consensus       152 el~G~Yy~L~~m----t~~~~~~Li~dHfLF~~~~~~~l~~ag~~rdWP~gRGIf~N  204 (357)
T cd00716         152 DLKGKYYPLSGM----TEEEQQQLIEDHFLFDKPVSPLLLSSGMARDWPDARGIWHN  204 (357)
T ss_pred             CCCCEEEECCCC----CHHHHHHHHHHHCCCCCCCCHHHHHCCCCCCCCCCCCEEEC
T ss_conf             338435547889----99999988872014158872788847785779877655874


No 8  
>pfam00341 PDGF Platelet-derived growth factor (PDGF).
Probab=13.58  E-value=83  Score=14.01  Aligned_cols=17  Identities=35%  Similarity=0.819  Sum_probs=10.0

Q ss_pred             CCCCEECCCCCCEEEEC
Q ss_conf             55202125676368722
Q gi|254781136|r   15 LSGEYISSKDQNFLYFP   31 (114)
Q Consensus        15 lsgeyisskdqnflyfp   31 (114)
                      ++.||....+.||+|+|
T Consensus        10 i~~e~pd~t~~~~if~P   26 (84)
T pfam00341        10 IFREYPDRTEANFLFWP   26 (84)
T ss_pred             EHHHCCCCCCEEEEEEC
T ss_conf             02536998740089808


No 9  
>PRK13386 fliH flagellar assembly protein H; Provisional
Probab=12.82  E-value=1.2e+02  Score=13.15  Aligned_cols=45  Identities=24%  Similarity=0.367  Sum_probs=23.7

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHCCCCCCC-EECCCCEEEEEEECCCCEEEE
Q ss_conf             68722317787787899987536566685-220554035775088644434
Q gi|254781136|r   27 FLYFPTEKQQLQENAFSILHNFWPTTKGP-IMRGGCRKICTLDSNSSIISA   76 (114)
Q Consensus        27 flyfptekqqlqenafsilhnfwpttkgp-imrggcrkictldsnssiisa   76 (114)
                      ...-|.....+.+.+-.-+ .-|.-..-| +.|||||-    ++..|.|.+
T Consensus       167 i~LnP~D~~~v~~~~~e~~-~~W~L~aD~~L~~GgCrv----~t~~s~vDa  212 (236)
T PRK13386        167 VHLNPAEFGRLKDLAPEKV-QAWGLVADPSLSAGECRI----VTDTSEADA  212 (236)
T ss_pred             EEECHHHHHHHHHHHHHHH-CCCEEEECCCCCCCCEEE----EECCCEEEC
T ss_conf             9989889999999744031-286674479758888699----858953531


No 10 
>PRK10125 predicted glycosyl transferase; Provisional
Probab=12.45  E-value=58  Score=14.95  Aligned_cols=21  Identities=29%  Similarity=0.631  Sum_probs=15.9

Q ss_pred             HHHHHCCCCCCCEECCCCEEE
Q ss_conf             987536566685220554035
Q gi|254781136|r   44 ILHNFWPTTKGPIMRGGCRKI   64 (114)
Q Consensus        44 ilhnfwpttkgpimrggcrki   64 (114)
                      -||..||-|-|-.--+||++-
T Consensus       132 TLHDmW~fTG~Chy~~~C~~w  152 (405)
T PRK10125        132 TLHDHWSVTGRCAFTDGCEGW  152 (405)
T ss_pred             EECCCCCCCCCCCCCCCHHHH
T ss_conf             943676556777887843767


Done!