Query         gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 114
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:30:42 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781136.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2caya1 b.55.1.12 (A:1-99,A:25  82.5    0.85 6.2E-05   23.0   4.4   62   47-108     2-68  (130)
  2 d2hthb1 b.55.1.12 (B:3-131) Va  26.3      20  0.0014   15.0   2.4   19   85-104    36-54  (129)
  3 d2dj7a1 g.39.1.3 (A:44-74) Act  17.1      16  0.0012   15.6   0.4   13   12-24      6-18  (31)
  4 d1pdga_ g.17.1.1 (A:) Platelet  16.8      15  0.0011   15.6   0.3   18   15-32     17-34  (96)
  5 d1tdja2 d.58.18.2 (A:336-423)   16.8      23  0.0017   14.6   1.1   35   55-90     11-47  (88)
  6 d2g9hd1 b.40.2.2 (D:4-86) Ente  11.3      37  0.0027   13.4   1.0   30    4-33      5-37  (83)
  7 d1icaa_ g.3.7.4 (A:) Defensin   10.0      37  0.0027   13.4   0.6   10  105-114    31-40  (40)
  8 d1t0ga_ d.120.1.2 (A:) Putativ  10.0      51  0.0037   12.6   1.6   19   85-103    27-45  (109)
  9 d1i2ta_ a.144.1.1 (A:) hyperpl   7.7      63  0.0046   12.0   1.1   24   33-56      1-24  (61)
 10 d1soxa2 d.120.1.1 (A:3-93) Sul   6.7      72  0.0052   11.7   2.1   15   86-100    19-33  (91)

No 1  
>d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=82.50  E-value=0.85  Score=22.98  Aligned_cols=62  Identities=21%  Similarity=0.341  Sum_probs=36.6

Q ss_pred             HHCC-----CCCCCEECCCCEEEEEEECCCCEEEEEEECCCCEEEEEEECCCEEEEECCCCCCCCCE
Q ss_conf             5365-----6668522055403577508864443442045540278862460666512422233201
Q gi|254781136|r   47 NFWP-----TTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSAT  108 (114)
Q Consensus        47 nfwp-----ttkgpimrggcrkictldsnssiisafsyrsstqqrvflanhreiydvtdassmqsat  108 (114)
                      +||-     +.-+|++..|-.-+...|.-.---....-..--.-+++|.|||-||--.+..+++|-.
T Consensus         2 ~~w~~~~~t~sg~p~L~~~E~~l~~qd~V~Ly~g~~k~~~~~~G~l~LTshRiI~v~~~~~~~~S~s   68 (130)
T d2caya1           2 EYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLG   68 (130)
T ss_dssp             GTCEECCBCTTSCBCCCTTCCEEEEEEEEEEEETTEECTTCSSEEEEEESSEEEEEESSCHHHHCEE
T ss_pred             CCCCHHHCCCCCCEECCCCEEEEEEECCEEEEECCCCCCCCCCCEEEEEEEEEEEECCCCCCEEEEE
T ss_conf             6321100126897671599079998277787889846756557559987327998169997414898


No 2  
>d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]}
Probab=26.32  E-value=20  Score=15.03  Aligned_cols=19  Identities=21%  Similarity=0.406  Sum_probs=11.5

Q ss_pred             EEEEEECCCEEEEECCCCCC
Q ss_conf             27886246066651242223
Q gi|254781136|r   85 QRVFLANHREIYDVTDASSM  104 (114)
Q Consensus        85 qrvflanhreiydvtdassm  104 (114)
                      -+++|.+||-||. .++..+
T Consensus        36 G~l~LTthRli~~-~~~~~~   54 (129)
T d2hthb1          36 GTLLLSTHRLIWR-DQKNHE   54 (129)
T ss_dssp             EEEEEESSEEEEE-ETTCCS
T ss_pred             EEEEEEECEEEEE-CCCCCC
T ss_conf             2899982459994-599976


No 3  
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]}
Probab=17.13  E-value=16  Score=15.56  Aligned_cols=13  Identities=54%  Similarity=0.708  Sum_probs=9.0

Q ss_pred             CCCCCCCEECCCC
Q ss_conf             6675520212567
Q gi|254781136|r   12 SNNLSGEYISSKD   24 (114)
Q Consensus        12 snnlsgeyisskd   24 (114)
                      +.-|.|||||...
T Consensus         6 ~~vL~gEYm~kdG   18 (31)
T d2dj7a1           6 SVILTGEYISKDG   18 (31)
T ss_dssp             CCBCSSCCEEETT
T ss_pred             CCCCCCEEECCCC
T ss_conf             7461101316799


No 4  
>d1pdga_ g.17.1.1 (A:) Platelet-derived growth factor BB {Human (Homo sapiens) [TaxId: 9606]}
Probab=16.84  E-value=15  Score=15.63  Aligned_cols=18  Identities=33%  Similarity=0.663  Sum_probs=11.7

Q ss_pred             CCCCEECCCCCCEEEECC
Q ss_conf             552021256763687223
Q gi|254781136|r   15 LSGEYISSKDQNFLYFPT   32 (114)
Q Consensus        15 lsgeyisskdqnflyfpt   32 (114)
                      +.-||-...+.||+|||.
T Consensus        17 i~~e~~d~t~~~~~y~P~   34 (96)
T d1pdga_          17 ISRRLIDRTNANFLVWPP   34 (96)
T ss_dssp             CCC---------CCEESS
T ss_pred             EEHHCCCCCCCCEEEECC
T ss_conf             521049986641589378


No 5  
>d1tdja2 d.58.18.2 (A:336-423) Allosteric threonine deaminase C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=16.79  E-value=23  Score=14.64  Aligned_cols=35  Identities=26%  Similarity=0.555  Sum_probs=23.3

Q ss_pred             CEECCCCEEEEEEECCCCEEEEEEECCC--CEEEEEEE
Q ss_conf             5220554035775088644434420455--40278862
Q gi|254781136|r   55 PIMRGGCRKICTLDSNSSIISAFSYRSS--TQQRVFLA   90 (114)
Q Consensus        55 pimrggcrkictldsnssiisafsyrss--tqqrvfla   90 (114)
                      |--.|.-++.|.+=.+ .-|+.|+||.+  ...+||+.
T Consensus        11 PErpGaf~~F~~~lg~-~nITeF~YR~~~~~~a~VlvG   47 (88)
T d1tdja2          11 PEEKGSFLKFCQLLGG-RSVTEFNYRFADAKNACIFVG   47 (88)
T ss_dssp             CBSSSCSHHHHHTTSS-SEEEEEEEECCCSSBCEEEEE
T ss_pred             CCCCCHHHHHHHHCCC-CCEEEEEEECCCCCCEEEEEE
T ss_conf             8896599999985275-726799987048987189999


No 6  
>d2g9hd1 b.40.2.2 (D:4-86) Enterotoxin type I, SEI {Staphylococcus aureus [TaxId: 1280]}
Probab=11.32  E-value=37  Score=13.40  Aligned_cols=30  Identities=30%  Similarity=0.296  Sum_probs=23.2

Q ss_pred             HHHHHCCCCCCCCCCEECCCCC---CEEEECCC
Q ss_conf             5553114566755202125676---36872231
Q gi|254781136|r    4 FLRNQYFDSNNLSGEYISSKDQ---NFLYFPTE   33 (114)
Q Consensus         4 flrnqyfdsnnlsgeyisskdq---nflyfpte   33 (114)
                      =|||-|++.+-...|-+.+.||   +-|-|+..
T Consensus         5 NLrn~Y~~~~~v~~envks~dq~Lsh~Lif~~~   37 (83)
T d2g9hd1           5 NLRNFYTKHDYIDLKGLIDKNLPSANQLEFSTG   37 (83)
T ss_dssp             HHHHHHHTSCCEEEEEEEBCCCSCSSEEEEECS
T ss_pred             CHHHHHCCCCCEEECCCCCCCCCCCCEEEECCC
T ss_conf             377875248830001533588534213896168


No 7  
>d1icaa_ g.3.7.4 (A:) Defensin A {Flesh fly (Phormia terranovae) [TaxId: 34676]}
Probab=10.04  E-value=37  Score=13.42  Aligned_cols=10  Identities=50%  Similarity=1.165  Sum_probs=6.4

Q ss_pred             CCCEEEEECC
Q ss_conf             3201567619
Q gi|254781136|r  105 QSATVCVCRE  114 (114)
Q Consensus       105 qsatvcvcre  114 (114)
                      .+..|||||.
T Consensus        31 n~k~VCvCRn   40 (40)
T d1icaa_          31 NGKGVCVCRN   40 (40)
T ss_dssp             CSSSCEECCC
T ss_pred             CCCEEEEECC
T ss_conf             8985777279


No 8  
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
Probab=10.02  E-value=51  Score=12.59  Aligned_cols=19  Identities=26%  Similarity=0.559  Sum_probs=14.9

Q ss_pred             EEEEEECCCEEEEECCCCC
Q ss_conf             2788624606665124222
Q gi|254781136|r   85 QRVFLANHREIYDVTDASS  103 (114)
Q Consensus        85 qrvflanhreiydvtdass  103 (114)
                      .++++|-.-.|||||....
T Consensus        27 ~piyvAi~G~VyDVt~~~~   45 (109)
T d1t0ga_          27 KPIYVAIKGRVFDVTTGKS   45 (109)
T ss_dssp             CCCEEEETTEEEECGGGTT
T ss_pred             CCEEEEECCEEEECCCCCC
T ss_conf             5279998999987367764


No 9  
>d1i2ta_ a.144.1.1 (A:) hyperplastic discs protein {Human (Homo sapiens) [TaxId: 9606]}
Probab=7.74  E-value=63  Score=12.03  Aligned_cols=24  Identities=21%  Similarity=0.354  Sum_probs=19.7

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             177877878999875365666852
Q gi|254781136|r   33 EKQQLQENAFSILHNFWPTTKGPI   56 (114)
Q Consensus        33 ekqqlqenafsilhnfwpttkgpi   56 (114)
                      .||.|-|.-|...+...|..-|-|
T Consensus         1 qk~~LGE~Ly~~V~~~~p~~A~KI   24 (61)
T d1i2ta_           1 HRQALGERLYPRVQAMQPAFASKI   24 (61)
T ss_dssp             CHHHHHHHHHHHHHHHCGGGHHHH
T ss_pred             CHHHHHHHHHHHHHHHCHHHHCCH
T ss_conf             958888886899998780010105


No 10 
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
Probab=6.70  E-value=72  Score=11.73  Aligned_cols=15  Identities=40%  Similarity=0.886  Sum_probs=0.0

Q ss_pred             EEEEECCCEEEEECC
Q ss_conf             788624606665124
Q gi|254781136|r   86 RVFLANHREIYDVTD  100 (114)
Q Consensus        86 rvflanhreiydvtd  100 (114)
                      +..+.-+..+||||+
T Consensus        19 ~~Wiii~g~VYDvT~   33 (91)
T d1soxa2          19 RVWVTHGTDVFDVTD   33 (91)
T ss_dssp             EEEEEETTEEEECTT
T ss_pred             CEEEEECCEEEECCC
T ss_conf             659999999982201


Done!