RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >2z8l_A Exotoxin 3; OB fold, B-grAsp, sugar binding protein; HET: SIA NAG GAL FUC; 1.65A {Staphylococcus aureus} (A:28-105) Length = 78 Score = 24.7 bits (54), Expect = 4.5 Identities = 5/30 (16%), Positives = 14/30 (46%) Query: 9 YFDSNNLSGEYISSKDQNFLYFPTEKQQLQ 38 + N++G S +++L F ++ + Sbjct: 2 SKELKNVTGYRYSKGGKHYLIFDKHQKFTR 31 >2gjv_A Putative cytoplasmic protein; structural genomics, unknown function, PSI, protein structure initiative; 2.39A {Salmonella typhimurium} (A:) Length = 175 Score = 24.4 bits (53), Expect = 6.0 Identities = 8/41 (19%), Positives = 13/41 (31%), Gaps = 5/41 (12%) Query: 7 NQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHN 47 N YF SN + + N L ++ + I Sbjct: 17 NLYFQSNAMETLSVIHTVANRL-----RELNPDMDIHISST 52 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 24.1 bits (52), Expect = 6.1 Identities = 11/57 (19%), Positives = 19/57 (33%), Gaps = 14/57 (24%) Query: 15 LSGEYISSKDQNFLYFPTE---------KQQLQENAFSILHNFW---PTTKGPIMRG 59 L E ++ F E + QL+ ++F+ P P+ RG Sbjct: 51 LKLEAEEIPSEDQNEFLLERTREIHNEAESQLRAAQQQWGNDFYKRDPRI-APL-RG 105 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.130 0.386 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 756,284 Number of extensions: 25909 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 5 Length of query: 114 Length of database: 4,956,049 Length adjustment: 68 Effective length of query: 46 Effective length of database: 2,657,309 Effective search space: 122236214 Effective search space used: 122236214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.2 bits)