Query         gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 195
No_of_seqs    27 out of 29
Neff          4.7 
Searched_HMMs 39220
Date          Mon May 30 05:08:48 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781137.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA00662 hypothetical protein   94.8    0.13 3.3E-06   30.1   6.7  137    2-169     3-151 (215)
  2 PHA00428 tail tubular protein   68.3     8.4 0.00021   19.5   4.0   72    1-73      9-84  (193)
  3 PRK07740 hypothetical protein;  65.7     7.6 0.00019   19.7   3.3   99    4-103     5-115 (240)
  4 KOG4690 consensus               39.7      22 0.00057   17.0   2.2   21  174-194    99-119 (165)
  5 TIGR01418 PEP_synth phosphoeno  38.8      22 0.00057   17.0   2.1   26   26-51     68-93  (877)
  6 TIGR02625 YiiL_rotase L-rhamno  37.2      17 0.00044   17.6   1.3   24   39-62     11-39  (102)
  7 pfam11216 DUF3012 Protein of u  33.5     6.2 0.00016   20.3  -1.4   22  129-150     3-24  (32)
  8 pfam07067 DUF1340 Protein of u  30.8      45  0.0012   15.2   2.9   44    2-53    151-199 (236)
  9 cd01543 PBP1_XylR Ligand-bindi  28.5      50  0.0013   15.0   4.2   25    2-29     15-39  (265)
 10 COG5455 Predicted integral mem  25.8      56  0.0014   14.7   3.2   24  107-130   105-128 (129)
 11 TIGR00514 accC acetyl-CoA carb  25.3      50  0.0013   14.9   2.0   26    7-33     17-42  (451)
 12 COG2957 Peptidylarginine deimi  25.2      42  0.0011   15.4   1.6   62  125-195   144-205 (346)
 13 pfam11886 DUF3406 Domain of un  25.0      20 0.00052   17.2  -0.0   40   63-102    13-55  (275)
 14 pfam10816 DUF2760 Domain of un  24.8      57  0.0014   14.6   2.2   20   25-44      2-21  (126)
 15 COG4106 Tam Trans-aconitate me  24.0      60  0.0015   14.5   3.2   89   12-102   114-207 (257)
 16 pfam09150 Carot_N Orange carot  23.7      24 0.00062   16.8   0.2   49   26-74     70-133 (159)
 17 TIGR01788 Glu-decarb-GAD gluta  20.9      45  0.0012   15.2   1.1   32   39-70    226-258 (493)
 18 TIGR01307 pgm_bpd_ind 2,3-bisp  20.1      43  0.0011   15.3   0.8   64    1-64    383-479 (529)

No 1  
>PHA00662 hypothetical protein
Probab=94.84  E-value=0.13  Score=30.08  Aligned_cols=137  Identities=17%  Similarity=0.214  Sum_probs=88.6

Q ss_pred             CHHHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCC-----CC----CCCCCCHHHHH
Q ss_conf             4899999999981988863111389988999999999999999972580467665403-----45----66778856653
Q gi|254781137|r    2 NVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKI-----DH----WPFHLPQDYYR   72 (195)
Q Consensus         2 tlLsiiq~v~~~igl~~P~aV~~stDp~~~qllal~~~~g~el~~~~dW~~l~~e~t~-----~~----~~~~lP~Dy~R   72 (195)
                      |...|.|.|...||-.+|.+-+.-..+..++.-.+=..+-+.++++|+|.-.++....     .+    ..|.||+|.-|
T Consensus         3 S~v~Icn~AL~~lG~~~~I~s~~e~s~~A~~c~~~Y~~~r~~~L~~~~W~fA~~r~~La~~~~~p~~~~~ay~lP~DcLr   82 (215)
T PHA00662          3 SEVDICNRALAYIGDERTIASLNEGSKQAEYCARFYDFARDALLELHTWGFATKRAQLAAMGISPPEWRYAYAQPADAIR   82 (215)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCEEECCCHHHHEE
T ss_conf             48999999999857788614777899899999988899999999739745465433343047899876442338157156


Q ss_pred             HCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCE---EECCCEEEECCCCCEEEEEECCCCEECCCCCCCCCCCCCCC
Q ss_conf             236641000352002887771345555421148717---84574333358975068861136120588754210025676
Q gi|254781137|r   73 PLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWY---WIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDD  149 (195)
Q Consensus        73 ~v~~~~~~~~~~~~~~p~~~~~~W~~~~~~~~~p~~---~i~g~~~~~~~~~~~~feYiSknWv~ss~g~~k~~~taDtD  149 (195)
                      ...-. ...    ...+.. ..+-       ..++.   .+-|+ .++...+.+...||++.                ||
T Consensus        83 v~~v~-~~~----~~~~~~-~~~~-------~~~~~~e~~~~G~-~I~td~~~~~l~Yi~rv----------------tD  132 (215)
T PHA00662         83 IVAVL-PHG----AANIEA-GIDN-------AQPFSCEIDNTGD-IILTNQVNAVARYISRV----------------TD  132 (215)
T ss_pred             EEEEE-CCC----CCCCCC-CCCC-------CCCEEEEECCCCC-EEEECCCCCEEEEEEEC----------------CC
T ss_conf             66772-388----655543-3345-------6522443056688-68826986189999845----------------88


Q ss_pred             CEECHHHHHHHHHHHHHHHH
Q ss_conf             12222899986789999871
Q gi|254781137|r  150 STLLPTYLLIKDIIWRWRRA  169 (195)
Q Consensus       150 t~~l~erLl~LgliWRwkra  169 (195)
                      +..||.. +..-|.||.-..
T Consensus       133 ~~~fd~~-F~~aLa~~LAa~  151 (215)
T PHA00662        133 TNKFDAL-FVEALAWRLAAM  151 (215)
T ss_pred             HHHCCHH-HHHHHHHHHHHH
T ss_conf             0338899-999999999999


No 2  
>PHA00428 tail tubular protein A
Probab=68.29  E-value=8.4  Score=19.48  Aligned_cols=72  Identities=14%  Similarity=0.158  Sum_probs=47.2

Q ss_pred             CCHHHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCC----CCCCHHHHHH
Q ss_conf             948999999999819888631113899889999999999999999725804676654034566----7788566532
Q gi|254781137|r    1 MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWP----FHLPQDYYRP   73 (195)
Q Consensus         1 MtlLsiiq~v~~~igl~~P~aV~~stDp~~~qllal~~~~g~el~~~~dW~~l~~e~t~~~~~----~~lP~Dy~R~   73 (195)
                      ||-|.+||.+..-|| ..|-+-...+.|.+..-...+.+.-+++-..+=|=+.-..+++.+-+    -.+|++.-|+
T Consensus         9 ~teL~AVN~iL~~IG-eaPV~sLd~~npd~~~A~~~L~ev~r~VQseGW~FNTE~~~~ltpd~~~~~I~vP~n~L~v   84 (193)
T PHA00428          9 LTELDAVNDILASIG-EPPVTTLDDTNPDVANARRILNDINRQVQSEGWTFNIEEGATLTPDPFTGRINLPSDYLSF   84 (193)
T ss_pred             CCHHHHHHHHHHHCC-CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEECCCCCEEEEECCCCCEEECCCCEEEE
T ss_conf             334899999999718-7876435678967999999999998999860524222325574126999959356548999


No 3  
>PRK07740 hypothetical protein; Provisional
Probab=65.70  E-value=7.6  Score=19.73  Aligned_cols=99  Identities=16%  Similarity=0.055  Sum_probs=66.8

Q ss_pred             HHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCC---CCCCCCCCHHH-HHHCCCCCC
Q ss_conf             99999999981988863111389988999999999999999972580467665403---45667788566-532366410
Q gi|254781137|r    4 LAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKI---DHWPFHLPQDY-YRPLLGGAM   79 (195)
Q Consensus         4 Lsiiq~v~~~igl~~P~aV~~stDp~~~qllal~~~~g~el~~~~dW~~l~~e~t~---~~~~~~lP~Dy-~R~v~~~~~   79 (195)
                      -..+|++-+.+++..|....++.|++++|+. ..-+.-+|.-+.-+|...+.+.+|   +.++-.|-++. ||.+.=+.+
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~r~~~k~~~~~~~~~~PL~~~~fvV~D~ETTGl~p~~gD~IIeIgAV   83 (240)
T PRK07740          5 HRFMQQLSRLLSLGVPRDASTALDPSAQQEA-WLRSLQKEKKHTDVLHDPLTDLPFVVFDLETTGFSPDQGDEILSIAAV   83 (240)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCHHHHH-HHHHHHHHCCCHHHCCCCCCCCEEEEEEEECCCCCCCCCCEEEEEEEE
T ss_conf             8999999975589886664455672044899-999999840570211895433838999805899898889878999899


Q ss_pred             CCCCC-------CCCCCCCC-HHHHHHHHHHC
Q ss_conf             00352-------00288777-13455554211
Q gi|254781137|r   80 VMLDL-------SLARPVIN-AVDWGIVKRIS  103 (195)
Q Consensus        80 ~~~~~-------~~~~p~~~-~~~W~~~~~~~  103 (195)
                      +....       ++.+|-.. |..=..+.||+
T Consensus        84 kv~~g~i~d~F~tLVnP~~~Ip~~i~~ltGIT  115 (240)
T PRK07740         84 KTVGGEVTDLYYSLVKPKKPIPEHILTLTGIS  115 (240)
T ss_pred             EEECCEEEEEEEEEECCCCCCCHHHHHHCCCC
T ss_conf             99999996887755088798998899860989


No 4  
>KOG4690 consensus
Probab=39.75  E-value=22  Score=17.01  Aligned_cols=21  Identities=14%  Similarity=0.210  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHCC
Q ss_conf             799999999998552433037
Q gi|254781137|r  174 FDDCLREFDLALIAEKILWLG  194 (195)
Q Consensus       174 Y~e~l~~Ye~al~qek~~~~~  194 (195)
                      |+|+|.+|++++..++--.+|
T Consensus        99 Y~DdLEdYN~~r~~a~~~i~~  119 (165)
T KOG4690          99 YSDDLEDYNHRRKEAAEKIAG  119 (165)
T ss_pred             HHHHHHHHHHHHHHHHHHHCC
T ss_conf             433689999998888887515


No 5  
>TIGR01418 PEP_synth phosphoenolpyruvate synthase; InterPro: IPR006319   This family represents phosphoenolpyruvate synthase; also called pyruvate,water dikinase and PEP synthase. The member from Methanococcus jannaschii contains a large intein. This enzyme generates phosphoenolpyruvate (PEP) from pyruvate, hydrolyzing ATP to AMP and releasing inorganic phosphate in the process. The enzyme shows extensive homology to other enzymes that use PEP as substrate or product. This enzyme may provide PEP for gluconeogenesis, for PTS-type carbohydrate transport systems, or for other processes. ; GO: 0008986 pyruvate water dikinase activity, 0006094 gluconeogenesis.
Probab=38.82  E-value=22  Score=17.01  Aligned_cols=26  Identities=19%  Similarity=0.206  Sum_probs=12.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             99889999999999999999725804
Q gi|254781137|r   26 QDESTVLLVSFLQQAGEEICLKVDWP   51 (195)
Q Consensus        26 tDp~~~qllal~~~~g~el~~~~dW~   51 (195)
                      +|-+=+.-|.-+.+.-++|....+-|
T Consensus        68 ~dv~D~~~L~~as~~iR~lI~~T~fP   93 (877)
T TIGR01418        68 LDVEDVEALEEASKEIRELILNTPFP   93 (877)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             48753689999999999986079998


No 6  
>TIGR02625 YiiL_rotase L-rhamnose 1-epimerase; InterPro: IPR013448    This entry contains rhamnose mutarotase from Escherichia coli, previously designated YiiL as an uncharacterised protein, and close homologs associated with rhamnose dissimilation operons in other bacterial genomes. Mutarotase is a term for an epimerase that changes optical activity. This enzyme was shown experimentally to interconvert alpha and beta stereoisomers of the pyranose form of L-rhamnose . The crystal structure of this small (104 amino acid) protein shows a locally asymmetric dimer with active site residues of His, Tyr, and Trp ..
Probab=37.19  E-value=17  Score=17.65  Aligned_cols=24  Identities=29%  Similarity=0.587  Sum_probs=16.7

Q ss_pred             HHHHHHHHHCC--CHHH---HHHHCCCCC
Q ss_conf             99999997258--0467---665403456
Q gi|254781137|r   39 QAGEEICLKVD--WPQL---LQEIKIDHW   62 (195)
Q Consensus        39 ~~g~el~~~~d--W~~l---~~e~t~~~~   62 (195)
                      ++-.|=.|||+  ||+|   +|.||....
T Consensus        11 D~h~EY~kRH~eiWPEl~~~LK~HGAhnY   39 (102)
T TIGR02625        11 DAHEEYKKRHNEIWPELKEVLKKHGAHNY   39 (102)
T ss_pred             CCHHHHHCCCCCCCHHHHHHHHHCCCCCC
T ss_conf             88466640688556458999876075110


No 7  
>pfam11216 DUF3012 Protein of unknown function (DUF3012). This family of proteins with unknown function is restricted to Gammaproteobacteria.
Probab=33.52  E-value=6.2  Score=20.27  Aligned_cols=22  Identities=27%  Similarity=0.481  Sum_probs=18.4

Q ss_pred             CCCCEECCCCCCCCCCCCCCCC
Q ss_conf             1361205887542100256761
Q gi|254781137|r  129 SKNWIIDSNKEAKHHITADDDS  150 (195)
Q Consensus       129 SknWv~ss~g~~k~~~taDtDt  150 (195)
                      |..||+.-...||.+||++..+
T Consensus         3 S~~WC~~m~ekPKgdWtanea~   24 (32)
T pfam11216         3 SEAWCEDMKEKPKGDWTANEAT   24 (32)
T ss_pred             CHHHHHHHHCCCCCCCCHHHHH
T ss_conf             1899999852884546075899


No 8  
>pfam07067 DUF1340 Protein of unknown function (DUF1340). This family consists of several hypothetical Streptococcus thermophilus bacteriophage proteins of around 235 residues in length. The function of this family is unknown.
Probab=30.81  E-value=45  Score=15.21  Aligned_cols=44  Identities=20%  Similarity=0.424  Sum_probs=24.9

Q ss_pred             CHHHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHH-----HHHHHHHHCCCHHH
Q ss_conf             48999999999819888631113899889999999999-----99999972580467
Q gi|254781137|r    2 NVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQ-----AGEEICLKVDWPQL   53 (195)
Q Consensus         2 tlLsiiq~v~~~igl~~P~aV~~stDp~~~qllal~~~-----~g~el~~~~dW~~l   53 (195)
                      |+.++||.+--|||+..|--|        +||--|+.+     .++-.--.+.||+-
T Consensus       151 ti~taint~yteigiltprkv--------iqlegllsrelfgkiakyvfnkyewpes  199 (236)
T pfam07067       151 TIRTAINTIYTEIGILTPRKV--------IQLEGLLSRELFGKIAKYVFNKYEWPES  199 (236)
T ss_pred             HHHHHHHHHHHHHHCCCHHHH--------HHHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             899999999998853561788--------8887487899988999998211458434


No 9  
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR). Ligand-binding domain of DNA transcription repressor specific for xylose (XylR), a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of XylR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=28.47  E-value=50  Score=14.97  Aligned_cols=25  Identities=16%  Similarity=0.104  Sum_probs=15.3

Q ss_pred             CHHHHHHHHHHHCCCCCCCEEECCCCHH
Q ss_conf             4899999999981988863111389988
Q gi|254781137|r    2 NVLAILNTVCDLVGLSRFETVYQNQDES   29 (195)
Q Consensus         2 tlLsiiq~v~~~igl~~P~aV~~stDp~   29 (195)
                      .++.=|.++|++-|.   ..++.+++..
T Consensus        15 ~vi~GIe~~a~~~Gy---~~il~~~~~~   39 (265)
T cd01543          15 GVLRGIARYAREHGP---WSIYLEPRGL   39 (265)
T ss_pred             HHHHHHHHHHHHCCC---EEEEECCCCH
T ss_conf             999999999997499---8999838234


No 10 
>COG5455 Predicted integral membrane protein [Function unknown]
Probab=25.76  E-value=56  Score=14.68  Aligned_cols=24  Identities=17%  Similarity=0.310  Sum_probs=21.0

Q ss_pred             CEEECCCEEEECCCCCEEEEEECC
Q ss_conf             178457433335897506886113
Q gi|254781137|r  107 WYWIDGRMIHLSINSPATFRYFSK  130 (195)
Q Consensus       107 ~~~i~g~~~~~~~~~~~~feYiSk  130 (195)
                      |.+.+|.+++++++.+.+|-|.+.
T Consensus       105 Wvrvg~dyvLi~~~tGlI~g~~a~  128 (129)
T COG5455         105 WVRVGGDYVLISDTTGLIFGVDAG  128 (129)
T ss_pred             EEEECCEEEEEEECCCEEEEEEEC
T ss_conf             589789189986057537762406


No 11 
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549   This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase. Acetyl-CoA carboxylase (6.4.1.2 from EC) is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase (6.3.4.14 from EC), and two subunits of carboxyl transferase in a 2:2 complex. In the first step of long-chain fatty acid synthesis, biotin carboxylase catalyses the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-coA. Homologous domains are found in eukaryotic forms of acetyl-CoA carboxylase and in a number of other carboxylases (e.g. pyruvate carboxylase). In some systems, the biotin carboxyl carrier protein and this protein (biotin carboxylase) may be shared by different carboxyltransferases. However, this model is not intended to identify the biotin carboxylase domain of propionyl-coA carboxylase. The model should hit the full length of proteins, except for chloroplast transit peptides in plants. If it hits a domain only of a longer protein, there may be a problem with the identification.; GO: 0016874 ligase activity.
Probab=25.34  E-value=50  Score=14.94  Aligned_cols=26  Identities=19%  Similarity=0.460  Sum_probs=19.9

Q ss_pred             HHHHHHHCCCCCCCEEECCCCHHHHHH
Q ss_conf             999999819888631113899889999
Q gi|254781137|r    7 LNTVCDLVGLSRFETVYQNQDESTVLL   33 (195)
Q Consensus         7 iq~v~~~igl~~P~aV~~stDp~~~ql   33 (195)
                      |=.+|.|+|+ ..-||||..|.++.-.
T Consensus        17 IiRAC~ElGi-~TVAVyS~aD~dalHV   42 (451)
T TIGR00514        17 IIRACKELGI-ATVAVYSTADRDALHV   42 (451)
T ss_pred             HHHHHHHCCC-CEEEECCHHHHHHHHH
T ss_conf             9998886498-6398600441332343


No 12 
>COG2957 Peptidylarginine deiminase and related enzymes [Amino acid transport and metabolism]
Probab=25.19  E-value=42  Score=15.38  Aligned_cols=62  Identities=24%  Similarity=0.303  Sum_probs=34.8

Q ss_pred             EEEECCCCEECCCCCCCCCCCCCCCCEECHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             88611361205887542100256761222289998678999987169997999999999985524330379
Q gi|254781137|r  125 FRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG  195 (195)
Q Consensus       125 feYiSknWv~ss~g~~k~~~taDtDt~~l~erLl~LgliWRwkraKGldY~e~l~~Ye~al~qek~~~~~~  195 (195)
                      -+|.+...|+-+|     ++-.|.+-.+|-.+---|.    =-|+-+++-.+-=..--..|.+|||+||+.
T Consensus       144 ~~~~~~~fiLEGG-----si~~dG~Gt~LTT~~CLLn----~nRNPhl~~~~ie~~L~e~Lg~kkvlWL~~  205 (346)
T COG2957         144 APLKTDPFILEGG-----SIHSDGEGTLLTTEQCLLN----DNRNPHLNQEGIENKLKEYLGAKKVLWLEY  205 (346)
T ss_pred             CCCCCCCEEEECC-----CEEECCCEEEEEEHHHHCC----CCCCCCCCHHHHHHHHHHHHCCCEEEECCC
T ss_conf             7545587356367-----2401586438854576558----998988588899999999857627898267


No 13 
>pfam11886 DUF3406 Domain of unknown function (DUF3406). This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is about 270 amino acids in length. This domain is found associated with pfam04548.
Probab=25.04  E-value=20  Score=17.24  Aligned_cols=40  Identities=18%  Similarity=0.196  Sum_probs=25.4

Q ss_pred             CCCCCHHHHHHCCCCCCC---CCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             677885665323664100---0352002887771345555421
Q gi|254781137|r   63 PFHLPQDYYRPLLGGAMV---MLDLSLARPVINAVDWGIVKRI  102 (195)
Q Consensus        63 ~~~lP~Dy~R~v~~~~~~---~~~~~~~~p~~~~~~W~~~~~~  102 (195)
                      ...+|+.||.=.|..--|   +.+.=++|||.+++.|++=.++
T Consensus        13 Dm~lP~SFDsD~P~hRYR~L~~~~q~lvRPVld~hGWDHD~G~   55 (275)
T pfam11886        13 DMVLPPSFDSDNPAHRYRCLEPTSQWLVRPVLDTHGWDHDCGY   55 (275)
T ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCCCCCCCCCC
T ss_conf             6658886588994214572157640157503168776433685


No 14 
>pfam10816 DUF2760 Domain of unknown function (DUF2760). This is a bacterial family of uncharacterized proteins.
Probab=24.76  E-value=57  Score=14.63  Aligned_cols=20  Identities=20%  Similarity=0.371  Sum_probs=14.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHH
Q ss_conf             89988999999999999999
Q gi|254781137|r   25 NQDESTVLLVSFLQQAGEEI   44 (195)
Q Consensus        25 stDp~~~qllal~~~~g~el   44 (195)
                      +++..+.|||++++++|+=+
T Consensus         2 ~~~~~AlqLL~lLQre~Rli   21 (126)
T pfam10816         2 PTPDAALQLLALLQREARLI   21 (126)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             88258999999987631588


No 15 
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]
Probab=23.95  E-value=60  Score=14.47  Aligned_cols=89  Identities=20%  Similarity=0.103  Sum_probs=54.4

Q ss_pred             HHCCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCCCC--CCCC
Q ss_conf             98198886311138998899999999999999997258046766540345667788566532366410003520--0288
Q gi|254781137|r   12 DLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLS--LARP   89 (195)
Q Consensus        12 ~~igl~~P~aV~~stDp~~~qllal~~~~g~el~~~~dW~~l~~e~t~~~~~~~lP~Dy~R~v~~~~~~~~~~~--~~~p   89 (195)
                      +.++..+|..|..-.=|.-  +..=+.+.-+|.+++..|...+...++...+...|+.|.........+...|.  -++|
T Consensus       114 rL~~~L~Pgg~LAVQmPdN--~depsH~~mr~~A~~~p~~~~l~~~~~~r~~v~s~a~Yy~lLa~~~~rvDiW~T~Y~h~  191 (257)
T COG4106         114 RLVSQLAPGGVLAVQMPDN--LDEPSHRLMRETADEAPFAQELGGRGLTRAPLPSPAAYYELLAPLACRVDIWHTTYYHQ  191 (257)
T ss_pred             HHHHHHCCCCEEEEECCCC--CCCHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCEEEEEEEECCCC
T ss_conf             9998508885699978876--47645799999874283666627665446778998999998576543255454123433


Q ss_pred             CCCH---HHHHHHHHH
Q ss_conf             7771---345555421
Q gi|254781137|r   90 VINA---VDWGIVKRI  102 (195)
Q Consensus        90 ~~~~---~~W~~~~~~  102 (195)
                      +++.   .||-.-+++
T Consensus       192 l~~a~aIvdWvkgTgL  207 (257)
T COG4106         192 LPGADAIVDWVKGTGL  207 (257)
T ss_pred             CCCCCCHHHHEECCCC
T ss_conf             7986322211002454


No 16 
>pfam09150 Carot_N Orange carotenoid protein, N-terminal. Members of this family adopt an alpha-helical structure consisting of two four-helix bundles. They are predominantly found in prokaryotic orange carotenoid protein, and carotenoid binding proteins.
Probab=23.72  E-value=24  Score=16.77  Aligned_cols=49  Identities=6%  Similarity=0.083  Sum_probs=31.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHC-CCHHHHH------------HHCCC--CCCCCCCHHHHHHC
Q ss_conf             99889999999999999999725-8046766------------54034--56677885665323
Q gi|254781137|r   26 QDESTVLLVSFLQQAGEEICLKV-DWPQLLQ------------EIKID--HWPFHLPQDYYRPL   74 (195)
Q Consensus        26 tDp~~~qllal~~~~g~el~~~~-dW~~l~~------------e~t~~--~~~~~lP~Dy~R~v   74 (195)
                      .+++..-|++|++++.-+|.|.| -|..-+|            +-++.  +..|+|+.+-+.++
T Consensus        70 ~~EQlq~MrDL~~~~dt~isR~Y~~ls~n~KL~fWY~Lae~M~~G~VipvP~~Yqls~~a~~vl  133 (159)
T pfam09150        70 FEEQLQVMRDLARREDTPLSREYGSLSENTKLGFWYQLAEWMEQGTVAPIPAGYQLSANANAVL  133 (159)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEECCCCCCCCCHHHHHHH
T ss_conf             9999999999984789788898860688407899999999860795740898887687899999


No 17 
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR010107   This entry represents Glutamate decarboxylase (gad;) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms .   Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium  and Gram-positive bacterium .   A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process.
Probab=20.88  E-value=45  Score=15.19  Aligned_cols=32  Identities=22%  Similarity=0.232  Sum_probs=17.8

Q ss_pred             HHHHHHHHHC-CCHHHHHHHCCCCCCCCCCHHH
Q ss_conf             9999999725-8046766540345667788566
Q gi|254781137|r   39 QAGEEICLKV-DWPQLLQEIKIDHWPFHLPQDY   70 (195)
Q Consensus        39 ~~g~el~~~~-dW~~l~~e~t~~~~~~~lP~Dy   70 (195)
                      ++=.++..++ ||...-.-+-+||+|..+=.=|
T Consensus       226 D~L~~~~~~~PDWsg~d~PiHvDAASGGFi~PF  258 (493)
T TIGR01788       226 DLLEELNAKTPDWSGWDIPIHVDAASGGFIAPF  258 (493)
T ss_pred             HHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCC
T ss_conf             999997427887477876647744678811376


No 18 
>TIGR01307 pgm_bpd_ind 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; InterPro: IPR005995   This 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGAM) is a metalloenzyme found particularly in eubacteria and higher plants. It is distantly related to archaeal iPGAM (IPR004456 from INTERPRO) and distinct from the unrelated cofactor-dependent PGAM (PIRSF001490 from PIRSF). Activity has been demonstrated for proteins from a variety of organisms, including Pseudomonas syringae pv. tomato , Bacillus subtilis , Bacillus stearothermophilus , maize , castor bean , and Trypanosoma brucei . The structure of the B. stearothermophilus enzyme (PDB:1EJJ) has two domains . Residues 1-76 and 311-511 form the phosphatase domain, containing the active site residue and two metal-binding sites. This domain is similar to alkaline phosphatase (PDB:1ALK) and arylsulphatase (PDB:1AUK), which are members of the SCOP alkaline phosphatase-like superfamily, but there is meagre sequence similarity outside of the metal-binding segments. Residues 77-310 form the phosphotransferase domain, which is poorly conserved (or perhaps unrelated) in the archaeal enzymes.; GO: 0004619 phosphoglycerate mutase activity, 0006007 glucose catabolic process.
Probab=20.10  E-value=43  Score=15.34  Aligned_cols=64  Identities=19%  Similarity=0.301  Sum_probs=35.3

Q ss_pred             CCHHHHHHHHHHHCCCCCCCEE---ECC-------------------CCHHHHHHHHHHHHHHHHHHHHCC---------
Q ss_conf             9489999999998198886311---138-------------------998899999999999999997258---------
Q gi|254781137|r    1 MNVLAILNTVCDLVGLSRFETV---YQN-------------------QDESTVLLVSFLQQAGEEICLKVD---------   49 (195)
Q Consensus         1 MtlLsiiq~v~~~igl~~P~aV---~~s-------------------tDp~~~qllal~~~~g~el~~~~d---------   49 (195)
                      ||+-.+=+.+|+.|-...++.|   |.|                   .|.++-.++..+++.|..+.--+|         
T Consensus       383 MSa~avTd~~~~~~~~g~~d~~v~NyANpDMVGHTG~~~Aai~AvEA~D~~~gri~~~~~~~g~~~llTADHGNAE~M~D  462 (529)
T TIGR01307       383 MSAKAVTDAVLEAIAQGKYDLIVVNYANPDMVGHTGNFEAAIKAVEALDVCLGRIVEACKKVGGTLLLTADHGNAEEMKD  462 (529)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC
T ss_conf             00188999999998368951899846842964647728999999999879999999999748962999605566001678


Q ss_pred             -CH-HHHHHHCCCCCCC
Q ss_conf             -04-6766540345667
Q gi|254781137|r   50 -WP-QLLQEIKIDHWPF   64 (195)
Q Consensus        50 -W~-~l~~e~t~~~~~~   64 (195)
                       =+ +..+.||+.++|+
T Consensus       463 e~~G~P~T~HT~npVPf  479 (529)
T TIGR01307       463 ENGGNPHTAHTTNPVPF  479 (529)
T ss_pred             CCCCCCCCCCCCCCCCE
T ss_conf             88877301155786346


Done!