BLAST/PSIBLAST alignment of GI: 254781137 and GI: 117925016 at iteration 1
>gi|117925016|ref|YP_865633.1| hypothetical protein Mmc1_1719 [Magnetococcus sp. MC-1] Length = 233
>gi|117608772|gb|ABK44227.1| conserved hypothetical protein [Magnetococcus sp. MC-1] Length = 233
 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 85/189 (44%), Gaps = 14/189 (7%)

Query: 1   MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKID 60
           M++L+++    DL+G+ R   V  + D +   L++  Q  G  +  +  WP++ +E    
Sbjct: 1   MSLLSMVQQAADLIGVQRPTQVVSSSDPTIRQLLAVAQMEGRTLAARGPWPEMTREASFT 60

Query: 61  HWPFHLPQDYYR--PLLGGAM--VMLDLSLARPV---INAVDWGIVK-RISHTPWYWIDG 112
                   D     P +   +   M + +  R V   ++A+DW   +   S TP+     
Sbjct: 61  TVAGQANYDLQSLVPDMDFLINNTMWNRTTGRVVGGPMSAMDWQANRAHGSATPFPTFRI 120

Query: 113 R-MIHLSINSPA-----TFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRW 166
           R  + +   +PA     +F Y SKNW   S  + +    AD D  +L  +L+   ++WR+
Sbjct: 121 REGVLMFAPTPAQSESYSFEYHSKNWCKSSAGDGQQGWQADSDVGILSEHLMTLGLVWRF 180

Query: 167 RRAQGLSFD 175
           ++A+G  + 
Sbjct: 181 KKAKGFDYS 189