BLAST/PSIBLAST alignment of GI: 254781137 and GI: 13470678 at iteration 1
>gi|13470678|ref|NP_102247.1| hypothetical protein mll0453 [Mesorhizobium loti MAFF303099] Length = 233
>gi|14021420|dbj|BAB48033.1| mll0453 [Mesorhizobium loti MAFF303099] Length = 233
 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 86/200 (43%), Gaps = 16/200 (8%)

Query: 1   MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKV-DWPQL--LQEI 57
           M +L+++  VC ++GL+    V+   D   V L +   +  + I     DW +   L  +
Sbjct: 1   MTILSVIQQVCPVIGLNVPTAVFSATDRELVELQALSNEMAQRIAFDTRDWTKFKTLCTL 60

Query: 58  KIDHWP--FHLPQDYYRPLLGGAMVMLDLSLARPVINAVD----WGIVKRISHT---PWY 108
             D     F+ P DY R +L  A V    S   P  +  D     GI  +   +    W 
Sbjct: 61  TGDGSTVGFNFPSDYKR-MLKKARVWPSASPFAPYTHYSDTDQWLGITVQNFRSIIGAWT 119

Query: 109 WIDGRMI---HLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWR 165
            I  +++    ++  S A F Y +   I D +   K   TADDD   L   +L   +IW+
Sbjct: 120 MIGEQILIKPAMANLSTAQFYYITNQIIKDKDGAPKVAFTADDDVFRLDERVLKLGMIWQ 179

Query: 166 WRRAQGLSFDDCLREFDLAL 185
           W+  +G ++ + +  ++ AL
Sbjct: 180 WKANKGQAYAEDMTNYEDAL 199