BLAST/PSIBLAST alignment of GI: 254781137 and GI: 315122530 at iteration 1
>gi|315122530|ref|YP_004063019.1| hypothetical protein CKC_03910 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 37
>gi|313495932|gb|ADR52531.1| hypothetical protein CKC_03910 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 37
 Score = 60.5 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 33/37 (89%)

Query: 1  MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFL 37
          M+VL +LNT+CDLVGLSRFE +Y+NQDE+ VLL+S L
Sbjct: 1  MSVLTLLNTICDLVGLSRFEKIYENQDENAVLLISLL 37