BLAST/PSIBLAST alignment of GI: 254781137 and GI: 327191476 at iteration 1
>gi|327191476|gb|EGE58496.1| hypothetical protein RHECNPAF_300006 [Rhizobium etli CNPAF512] Length = 234
 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 80/196 (40%), Gaps = 15/196 (7%)

Query: 1   MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLL-----Q 55
           M++L I+  VC  + L     V  + D   + L     +AG ++    DW  L+     Q
Sbjct: 1   MSLLTIIQNVCAEIDLDPPTAVMSSADPQIMQLRILSTRAGRDLMRAHDWSALMVRRQFQ 60

Query: 56  EIKIDHWPFHLPQDYYRPLLGGAM--VMLDLSLARPVINAVDWGIVKRISHTP----WYW 109
               +  P   P D+ R      +  V    SL  PV     W     ++  P    W  
Sbjct: 61  ATGANPEPDEPPGDWDRFAANARIWNVSRLWSLNGPV-EPQSWQRQTILAANPVPQIWRM 119

Query: 110 IDGRM-IHLSINSPA-TFRYFSKNWI-IDSNKEAKHHITADDDSTLLPTYLLIKDIIWRW 166
             GR+ I+ S+      + Y S  W+ ++    A  +   D D+   P  LL   +IWRW
Sbjct: 120 AGGRLDIYPSVAGETMEYAYISGFWVAVNGGATAAGNWANDTDTARFPEELLELSLIWRW 179

Query: 167 RRAQGLSFDDCLREFD 182
           +RA+GL + + L  F+
Sbjct: 180 KRAKGLDYGEELVSFE 195