RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >d2dpma_ c.66.1.28 (A:) DNA methylase DpnM {Streptococcus pneumoniae [TaxId: 1313]} Length = 275 Score = 28.3 bits (62), Expect = 0.44 Identities = 21/98 (21%), Positives = 35/98 (35%), Gaps = 5/98 (5%) Query: 52 QLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIV---KRISHTPWY 108 QLL I + P Y+ P +GG + DL+ VIN + ++ ++I P Sbjct: 14 QLLPVI-RELIPKT-YNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQE 71 Query: 109 WIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITA 146 I+ +H NS + + A Sbjct: 72 LIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRA 109 >d2evra2 d.3.1.16 (A:87-234) Cell wall-associated hydrolase Spr C-terminal domain {Nostoc punctiforme [TaxId: 272131]} Length = 148 Score = 26.6 bits (58), Expect = 1.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 96 WGIVKRISHTPWYWIDGRMIHLS 118 +G ++ +H Y DG IH S Sbjct: 82 FGTSQKATHVGLYLADGYYIHSS 104 >d1dq3a1 b.86.1.2 (A:1-128,A:415-454) PI-Pfui intein {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 168 Score = 24.6 bits (53), Expect = 5.3 Identities = 10/54 (18%), Positives = 14/54 (25%), Gaps = 3/54 (5%) Query: 142 HHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG 195 I P ++L D +RA L D L + I Sbjct: 91 TKILTSPWH---PFFVLTPDFKIVEKRADELKEGDILIGGMGLEVVRHITTTNE 141 >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Score = 24.7 bits (54), Expect = 5.7 Identities = 9/48 (18%), Positives = 18/48 (37%), Gaps = 9/48 (18%) Query: 155 TYLLIKD-IIWRWRR--AQGLSFDDCLR------EFDLALIAEKILWL 193 +L I++ + W L+F+ L+ D L+ +L Sbjct: 38 VFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYL 85 >d1yf3a1 c.66.1.28 (A:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]} Length = 259 Score = 24.5 bits (52), Expect = 6.5 Identities = 14/94 (14%), Positives = 35/94 (37%), Gaps = 7/94 (7%) Query: 52 QLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIV---KRISHTPWY 108 LL E+ H+P + + GG V L+++ + N + I+ KR+ + W Sbjct: 13 SLLPEL-KSHFPKY--NRFVDLFCGGLSVSLNVN-GPVLANDIQEPIIEMYKRLINVSWD 68 Query: 109 WIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKH 142 + + ++ + + + ++ Sbjct: 69 DVLKVIKQYKLSKTSKEEFLKLREDYNKTRDPLL 102 >d1ei7a_ a.24.5.1 (A:) Tobacco mosaic virus coat protein {Tobacco mosaic virus, vulgare strain [TaxId: 12242]} Length = 158 Score = 24.1 bits (52), Expect = 8.0 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 118 SINSPATFRYFSKNWI 133 SI +P+ F + S W Sbjct: 3 SITTPSQFVFLSSAWA 18 >d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Length = 136 Score = 24.0 bits (51), Expect = 8.1 Identities = 10/59 (16%), Positives = 18/59 (30%), Gaps = 8/59 (13%) Query: 96 WGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLP 154 W V R+ W +DG + +K + ++ + S L P Sbjct: 78 WVGVYRVGEGNWTSLDG--------GTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKP 128 >d1rmva_ a.24.5.1 (A:) Ribgrass mosaic virus {Ribgrass mosaic virus [TaxId: 51680]} Length = 156 Score = 24.0 bits (52), Expect = 8.7 Identities = 4/16 (25%), Positives = 9/16 (56%) Query: 118 SINSPATFRYFSKNWI 133 +I + ++YF+ W Sbjct: 3 NITNSNQYQYFAAVWA 18 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.141 0.462 Gapped Lambda K H 0.267 0.0500 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 813,011 Number of extensions: 37360 Number of successful extensions: 122 Number of sequences better than 10.0: 1 Number of HSP's gapped: 122 Number of HSP's successfully gapped: 20 Length of query: 195 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 114 Effective length of database: 1,295,466 Effective search space: 147683124 Effective search space used: 147683124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.6 bits)