Query         gi|254781139|ref|YP_003065552.1| hypothetical protein CLIBASIA_05205 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 65
No_of_seqs    3 out of 5
Neff          1.5 
Searched_HMMs 33803
Date          Wed Jun  1 22:44:13 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781139.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2ay1_A Aroat, aromatic amino   11.3      70  0.0021   15.4   0.4   17   11-27     87-103 (112)
  2 >3ce7_A Specific mitochodrial    9.7      97  0.0029   14.7   0.6   10   50-59     10-19  (47)
  3 >2wj6_A 1H-3-hydroxy-4-oxoquin   7.4 1.3E+02  0.0038   14.0   0.5   22   39-60     20-41  (69)
  4 >1r89_A TRNA nucleotidyltransf   7.2 1.7E+02  0.0051   13.4   1.0   19   41-61     13-31  (45)
  5 >2uvk_A YJHT; unknown function   6.8 1.4E+02  0.0042   13.9   0.4   15   11-25     38-52  (53)
  6 >3ibt_A 1H-3-hydroxy-4-oxoquin   6.6 1.5E+02  0.0045   13.7   0.5   22   39-60     20-41  (81)
  7 >2reu_A Type II restriction en   6.5 1.5E+02  0.0045   13.7   0.5   10   55-64     13-22  (33)
  8 >2kkm_A Translation machinery-   6.3 1.2E+02  0.0036   14.2  -0.2   30    7-36    110-139 (144)
  9 >1iuh_A 2'-5' RNA ligase; rike   5.6 1.5E+02  0.0044   13.7  -0.0   28   16-43    169-196 (198)
 10 >3lm3_A Uncharacterized protei   5.5 1.4E+02  0.0041   13.9  -0.2   14   50-63     42-55  (216)

No 1  
>>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} (A:46-86,A:283-337,A:379-394)
Probab=11.35  E-value=70  Score=15.43  Aligned_cols=17  Identities=12%  Similarity=0.130  Sum_probs=13.1

Q ss_pred             HHHHHCCEEEEHHCCHH
Q ss_conf             66431541000100042
Q gi|254781139|r   11 TRKKNRDWQRIASIPVS   27 (65)
Q Consensus        11 ~r~~~~dW~rvASiPln   27 (65)
                      +..-.++|..|+|||.-
T Consensus        87 ~~~~~~~wdhI~t~~~~  103 (112)
T 2ay1_A           87 DLSGSDRFGFDNTIPIL  103 (112)
T ss_dssp             HHHTSSTTTHTTTHHHH
T ss_pred             HHCCCCCEEEHHHHHHH
T ss_conf             85898864688889999


No 2  
>>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} (A:38-84)
Probab=9.67  E-value=97  Score=14.70  Aligned_cols=10  Identities=30%  Similarity=0.853  Sum_probs=7.6

Q ss_pred             HCCCCCCEEH
Q ss_conf             0266641000
Q gi|254781139|r   50 LNNRDNASWR   59 (65)
Q Consensus        50 LNn~DNraWR   59 (65)
                      ++.+|||+|-
T Consensus        10 ~~Trd~R~WD   19 (47)
T 3ce7_A           10 LRTREDRLWD   19 (47)
T ss_dssp             SBBTTSSBCC
T ss_pred             HHHHHHCCCC
T ss_conf             1266630887


No 3  
>>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* (A:131-199)
Probab=7.42  E-value=1.3e+02  Score=14.04  Aligned_cols=22  Identities=27%  Similarity=0.534  Sum_probs=18.1

Q ss_pred             CCCCHHHHHHHHCCCCCCEEHH
Q ss_conf             2540789999702666410000
Q gi|254781139|r   39 TEGDDVWVNKWLNNRDNASWRT   60 (65)
Q Consensus        39 sEGDD~~VkrwLNn~DNraWRt   60 (65)
                      .+|-|-+.+-||-+.||.+++-
T Consensus        20 ~~~r~~lf~~Wl~g~~n~~V~~   41 (69)
T 2wj6_A           20 REGTHGLFDVWLDGHDEKRVRH   41 (69)
T ss_dssp             HHHHHHHHHHHHTTBCCHHHHH
T ss_pred             HHHHHHHHHHHHCCCCHHHHHH
T ss_conf             6679999999741333166899


No 4  
>>1r89_A TRNA nucleotidyltransferase; CCA adding enzyme, incoming nucleotide, nucleotidyltransferase superfamily; HET: CTP; 1.80A {Archaeoglobus fulgidus} (A:338-382)
Probab=7.19  E-value=1.7e+02  Score=13.39  Aligned_cols=19  Identities=32%  Similarity=0.466  Sum_probs=12.9

Q ss_pred             CCHHHHHHHHCCCCCCEEHHC
Q ss_conf             407899997026664100002
Q gi|254781139|r   41 GDDVWVNKWLNNRDNASWRTS   61 (65)
Q Consensus        41 GDD~~VkrwLNn~DNraWRt~   61 (65)
                      -|.+-|+|||.  -|++.|.|
T Consensus        13 ede~nv~~fl~--rn~af~~f   31 (45)
T 1r89_A           13 EDERNVKKFLS--RNRAFRPF   31 (45)
T ss_dssp             TCHHHHHHHHH--SCCSSCCE
T ss_pred             CCHHHHHHHHH--HCCCCCCE
T ss_conf             50437998877--45765762


No 5  
>>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, E. coli, kelch repeat, beta-propeller, unknown function.; HET: MSE; 1.5A {Escherichia coli} (A:1-53)
Probab=6.80  E-value=1.4e+02  Score=13.86  Aligned_cols=15  Identities=33%  Similarity=0.904  Sum_probs=10.6

Q ss_pred             HHHHHCCEEEEHHCC
Q ss_conf             664315410001000
Q gi|254781139|r   11 TRKKNRDWQRIASIP   25 (65)
Q Consensus        11 ~r~~~~dW~rvASiP   25 (65)
                      ....+..|+++++.|
T Consensus        38 L~~~~~gW~~l~~~P   52 (53)
T 2uvk_A           38 TQAKDKKWTALAAFP   52 (53)
T ss_dssp             TTSSSCCEEECCCCT
T ss_pred             CCCCCCCEEECCCCC
T ss_conf             968999489999999


No 6  
>>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} (A:124-204)
Probab=6.58  E-value=1.5e+02  Score=13.67  Aligned_cols=22  Identities=23%  Similarity=0.525  Sum_probs=18.0

Q ss_pred             CCCCHHHHHHHHCCCCCCEEHH
Q ss_conf             2540789999702666410000
Q gi|254781139|r   39 TEGDDVWVNKWLNNRDNASWRT   60 (65)
Q Consensus        39 sEGDD~~VkrwLNn~DNraWRt   60 (65)
                      .+|-|-+.+-||-+.||.+++-
T Consensus        20 ~~~r~~lf~~Wl~g~~n~~V~~   41 (81)
T 3ibt_A           20 VAGRQSFFDEWAETTDNADVLN   41 (81)
T ss_dssp             HHHHHHHHHHHHTTCCCHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHH
T ss_conf             9999999999875123266899


No 7  
>>2reu_A Type II restriction enzyme SAU3AI; helix, beta, random coil, endonuclease, hydrolase, magnesium, nuclease, restriction system; 1.90A {Staphylococcus aureus} (A:87-119)
Probab=6.53  E-value=1.5e+02  Score=13.69  Aligned_cols=10  Identities=60%  Similarity=1.292  Sum_probs=6.6

Q ss_pred             CCEEHHCCCC
Q ss_conf             4100002376
Q gi|254781139|r   55 NASWRTSEGY   64 (65)
Q Consensus        55 NraWRt~EG~   64 (65)
                      |..|.++|||
T Consensus        13 ~eewe~segy   22 (33)
T 2reu_A           13 NEEWEDSEGY   22 (33)
T ss_dssp             TCCSBCTTSC
T ss_pred             CCCEECCHHH
T ss_conf             5603221567


No 8  
>>2kkm_A Translation machinery-associated protein 16; nucleus, structural genomics, PSI-2, protein structure initiative; NMR {Saccharomyces cerevisiae} (A:)
Probab=6.28  E-value=1.2e+02  Score=14.19  Aligned_cols=30  Identities=10%  Similarity=0.022  Sum_probs=19.0

Q ss_pred             HHHHHHHHHCCEEEEHHCCHHHHCCCCEEE
Q ss_conf             666666431541000100042220568120
Q gi|254781139|r    7 CAMATRKKNRDWQRIASIPVSILKDSHLLQ   36 (65)
Q Consensus         7 cama~r~~~~dW~rvASiPlnvah~~~Lvq   36 (65)
                      -...-|.|+|+|..+..+.+--....++.+
T Consensus       110 nv~~Lr~WnG~~~~l~~lk~irvs~~g~~~  139 (144)
T 2kkm_A          110 NMEFLRNWNGTFGLLNTLRLIRINDKGEQV  139 (144)
T ss_dssp             HHHHHHTCSSCSTHHHHSCEEEEETTTEEC
T ss_pred             HHHHHHHHCCCHHCCCCEEEEEECCCHHHH
T ss_conf             999999718982108610466667757774


No 9  
>>1iuh_A 2'-5' RNA ligase; riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} (A:)
Probab=5.64  E-value=1.5e+02  Score=13.73  Aligned_cols=28  Identities=7%  Similarity=0.010  Sum_probs=20.8

Q ss_pred             CCEEEEHHCCHHHHCCCCEEEEECCCCH
Q ss_conf             5410001000422205681201125407
Q gi|254781139|r   16 RDWQRIASIPVSILKDSHLLQAHTEGDD   43 (65)
Q Consensus        16 ~dW~rvASiPlnvah~~~LvqAHsEGDD   43 (65)
                      +-|+.++++||.-..+..-.|..++|.+
T Consensus       169 ~~~~~~~~~~L~~~~~~~~~~~~~~~~~  196 (198)
T 1iuh_A          169 PVYTVLEKFSLRGEHGREQAQGPGERPE  196 (198)
T ss_dssp             EEEEEEEEEECCCCC-------------
T ss_pred             CEEEEEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             8104989998989999999878767998


No 10 
>>3lm3_A Uncharacterized protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.44A {Parabacteroides distasonis} (A:1-142,A:249-322)
Probab=5.49  E-value=1.4e+02  Score=13.87  Aligned_cols=14  Identities=50%  Similarity=0.966  Sum_probs=0.0

Q ss_pred             HCCCCCCEEHHCCC
Q ss_conf             02666410000237
Q gi|254781139|r   50 LNNRDNASWRTSEG   63 (65)
Q Consensus        50 LNn~DNraWRt~EG   63 (65)
                      |.-+|.++|.|.||
T Consensus        42 lhprde~~whtleg   55 (216)
T 3lm3_A           42 LHPRDEVDWHTLEG   55 (216)
T ss_dssp             SSCCCCGGGCCHHH
T ss_pred             CCCCCCCCHHHHHH
T ss_conf             47766555135787


Done!