RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781139|ref|YP_003065552.1| hypothetical protein CLIBASIA_05205 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.0 bits (62), Expect = 0.54 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 3/19 (15%) Query: 23 SIPVSILKDSHLLQAHTEG 41 S+P SIL+DS + EG Sbjct: 318 SLPPSILEDS---LENNEG 333 Score = 27.2 bits (60), Expect = 0.84 Identities = 17/67 (25%), Positives = 26/67 (38%), Gaps = 31/67 (46%) Query: 15 NRDWQRIASIPVS---ILKDSHLLQ-AH----------TEGDDVWVNKWLNNRDNASWRT 60 ++D+ + SIP+S I ++Q AH T G+ L R T Sbjct: 227 DKDY--LLSIPISCPLI----GVIQLAHYVVTAKLLGFTPGE-------L--RSYLKGAT 271 Query: 61 --SEGYV 65 S+G V Sbjct: 272 GHSQGLV 278 Score = 26.8 bits (59), Expect = 1.2 Identities = 7/47 (14%), Positives = 16/47 (34%), Gaps = 11/47 (23%) Query: 19 QRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRTSEGYV 65 + + + T+G ++ +WL N N + Y+ Sbjct: 196 SELIRTTLDA--EKV----FTQGLNI--LEWLENPSN---TPDKDYL 231 Score = 25.3 bits (55), Expect = 3.0 Identities = 10/38 (26%), Positives = 13/38 (34%), Gaps = 12/38 (31%) Query: 5 QACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGD 42 A MA R P +S L +A EG+ Sbjct: 128 TARIMAKR------------PFDKKSNSALFRAVGEGN 153 >3ge3_B Toluene-4-monooxygenase system protein E; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_B 3i5j_B 3i63_B 3dhi_B* 3dhh_B* 3dhg_B* Length = 327 Score = 26.3 bits (58), Expect = 1.7 Identities = 6/49 (12%), Positives = 12/49 (24%) Query: 2 EINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWL 50 I+ C + T R A + ++W + Sbjct: 147 TISNCCILQTADSLRWLTHTAYRTHELSLTYPDAGLGEHERELWEKEPG 195 >2inc_B Toluene, O-xylene monooxygenase oxygenase subunit; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: a.25.1.2 PDB: 2rdb_B* 1t0r_B 1t0s_B 1t0q_B* 2ind_B* Length = 322 Score = 25.2 bits (55), Expect = 3.8 Identities = 8/49 (16%), Positives = 10/49 (20%) Query: 2 EINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWL 50 I T R A + + DVW N Sbjct: 143 TITNCATYETADHLRWLTHTAYRTRELANCYPDVGFGKRERDVWENDPA 191 >2end_A Endonuclease V; 1.45A {Enterobacteria phage T4} SCOP: a.18.1.1 PDB: 1enj_A 1eni_A 1enk_A 2fcc_A* 1vas_A* Length = 138 Score = 24.0 bits (52), Expect = 8.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Query: 20 RIASIPVSILKDSHLLQAHTE 40 RI VS L D HL+ + E Sbjct: 3 RINLTLVSELADQHLMAEYRE 23 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.316 0.127 0.409 Gapped Lambda K H 0.267 0.0651 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 568,279 Number of extensions: 17589 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 8 Length of query: 65 Length of database: 5,693,230 Length adjustment: 36 Effective length of query: 29 Effective length of database: 4,820,446 Effective search space: 139792934 Effective search space used: 139792934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.2 bits)