RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781139|ref|YP_003065552.1| hypothetical protein CLIBASIA_05205 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) >d2incb1 a.25.1.2 (B:8-329) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]} Length = 322 Score = 24.4 bits (53), Expect = 2.8 Identities = 8/49 (16%), Positives = 10/49 (20%) Query: 2 EINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWL 50 I T R A + + DVW N Sbjct: 143 TITNCATYETADHLRWLTHTAYRTRELANCYPDVGFGKRERDVWENDPA 191 >d2enda_ a.18.1.1 (A:) T4 endonuclease V {Bacteriophage T4 [TaxId: 10665]} Length = 137 Score = 24.0 bits (52), Expect = 3.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Query: 20 RIASIPVSILKDSHLLQAHTE 40 RI VS L D HL+ + E Sbjct: 2 RINLTLVSELADQHLMAEYRE 22 >d1c3ha_ b.22.1.1 (A:) 30 kDa adipocyte complement-related protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 137 Score = 23.4 bits (50), Expect = 5.3 Identities = 5/26 (19%), Positives = 10/26 (38%) Query: 39 TEGDDVWVNKWLNNRDNASWRTSEGY 64 GD VW+ + + N + + Sbjct: 99 EVGDQVWLQVYGDGDHNGLYADNVND 124 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.127 0.409 Gapped Lambda K H 0.267 0.0618 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 247,460 Number of extensions: 7820 Number of successful extensions: 15 Number of sequences better than 10.0: 1 Number of HSP's gapped: 15 Number of HSP's successfully gapped: 7 Length of query: 65 Length of database: 2,407,596 Length adjustment: 34 Effective length of query: 31 Effective length of database: 1,940,776 Effective search space: 60164056 Effective search space used: 60164056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.1 bits)