BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781140|ref|YP_003065553.1| hypothetical protein CLIBASIA_05210 [Candidatus Liberibacter asiaticus str. psy62] (44 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781140|ref|YP_003065553.1| hypothetical protein CLIBASIA_05210 [Candidatus Liberibacter asiaticus str. psy62] gi|254040817|gb|ACT57613.1| hypothetical protein CLIBASIA_05210 [Candidatus Liberibacter asiaticus str. psy62] Length = 44 Score = 89.7 bits (221), Expect = 1e-16, Method: Composition-based stats. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCIPSYGD 44 MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCIPSYGD Sbjct: 1 MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCIPSYGD 44 >gi|315122532|ref|YP_004063021.1| hypothetical protein CKC_03920 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495934|gb|ADR52533.1| hypothetical protein CKC_03920 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 118 Score = 60.8 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 25/29 (86%), Positives = 28/29 (96%) Query: 1 MDIYDGSWKLISYDPETGRTVWYMLDNQK 29 MDIYDGSWKLISYDPETGRT+WY+ DNQ+ Sbjct: 13 MDIYDGSWKLISYDPETGRTIWYLSDNQR 41 >gi|150397026|ref|YP_001327493.1| hypothetical protein Smed_1823 [Sinorhizobium medicae WSM419] gi|150028541|gb|ABR60658.1| hypothetical protein Smed_1823 [Sinorhizobium medicae WSM419] Length = 107 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 19/29 (65%) Query: 1 MDIYDGSWKLISYDPETGRTVWYMLDNQK 29 M I DGSW L YD TGR+VW+ D +K Sbjct: 1 MIIRDGSWSLYDYDQMTGRSVWHYFDGEK 29 >gi|227822440|ref|YP_002826412.1| hypothetical protein NGR_c18950 [Sinorhizobium fredii NGR234] gi|227341441|gb|ACP25659.1| hypothetical protein NGR_c18950 [Sinorhizobium fredii NGR234] Length = 107 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 18/29 (62%) Query: 1 MDIYDGSWKLISYDPETGRTVWYMLDNQK 29 M + DG WKL YD TGR+VW M D + Sbjct: 1 MIVRDGEWKLFDYDFLTGRSVWVMEDGNR 29 >gi|256371680|ref|YP_003109504.1| extracellular solute-binding protein family 5 [Acidimicrobium ferrooxidans DSM 10331] gi|256008264|gb|ACU53831.1| extracellular solute-binding protein family 5 [Acidimicrobium ferrooxidans DSM 10331] Length = 610 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/20 (70%), Positives = 16/20 (80%) Query: 3 IYDGSWKLISYDPETGRTVW 22 + DG WKL SYDP TGRTV+ Sbjct: 248 VVDGPWKLQSYDPTTGRTVF 267 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.139 0.473 Lambda K H 0.267 0.0428 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 506,345,765 Number of Sequences: 14124377 Number of extensions: 13331475 Number of successful extensions: 28963 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 28958 Number of HSP's gapped (non-prelim): 5 length of query: 44 length of database: 4,842,793,630 effective HSP length: 18 effective length of query: 26 effective length of database: 4,588,554,844 effective search space: 119302425944 effective search space used: 119302425944 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.8 bits)