RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781140|ref|YP_003065553.1| hypothetical protein CLIBASIA_05210 [Candidatus Liberibacter asiaticus str. psy62] (44 letters) >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Length = 144 Score = 23.4 bits (50), Expect = 5.6 Identities = 6/18 (33%), Positives = 7/18 (38%) Query: 7 SWKLISYDPETGRTVWYM 24 WKL+ PE G Sbjct: 31 RWKLLHVSPEMGSWTAIF 48 >d1dq3a1 b.86.1.2 (A:1-128,A:415-454) PI-Pfui intein {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 168 Score = 23.1 bits (49), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Query: 9 KLISYDPETGRTVW 22 + S+DPE+ R V Sbjct: 52 YVKSFDPESKRVVK 65 >g1ko6.1 b.119.1.1 (A:,B:) C-terminal autoproteolytic domain of nucleoporin nup98 {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Score = 22.8 bits (49), Expect = 8.3 Identities = 6/14 (42%), Positives = 7/14 (50%), Gaps = 2/14 (14%) Query: 9 KLISYDPETGRTVW 22 + Y PETG W Sbjct: 134 QFKEYRPETG--SW 145 >d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 113 Score = 22.6 bits (48), Expect = 9.1 Identities = 5/39 (12%), Positives = 12/39 (30%) Query: 1 MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCI 39 + W +++Y T R ++ V + Sbjct: 33 ISAEGSGWAVLTYCQRTDRLFIMQVEKHNVNVIPHFRIL 71 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.139 0.473 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 192,033 Number of extensions: 5595 Number of successful extensions: 35 Number of sequences better than 10.0: 1 Number of HSP's gapped: 35 Number of HSP's successfully gapped: 13 Length of query: 44 Length of database: 2,407,596 Length adjustment: 16 Effective length of query: 28 Effective length of database: 2,187,916 Effective search space: 61261648 Effective search space used: 61261648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.1 bits)