BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781140|ref|YP_003065553.1| hypothetical protein
CLIBASIA_05210 [Candidatus Liberibacter asiaticus str. psy62]
         (44 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781140|ref|YP_003065553.1| hypothetical protein CLIBASIA_05210 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 44

 Score = 93.2 bits (230), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%)

Query: 1  MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCIPSYGD 44
          MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCIPSYGD
Sbjct: 1  MDIYDGSWKLISYDPETGRTVWYMLDNQKRCVSDRLSCIPSYGD 44


>gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 1398

 Score = 21.9 bits (45), Expect = 2.0,   Method: Composition-based stats.
 Identities = 7/11 (63%), Positives = 9/11 (81%)

Query: 9   KLISYDPETGR 19
           K + +DPETGR
Sbjct: 702 KRVEFDPETGR 712


>gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 652

 Score = 21.2 bits (43), Expect = 3.5,   Method: Composition-based stats.
 Identities = 6/13 (46%), Positives = 10/13 (76%)

Query: 2   DIYDGSWKLISYD 14
           +IYDG W+  S++
Sbjct: 385 NIYDGIWRATSFN 397


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.139    0.473 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,502
Number of Sequences: 1233
Number of extensions: 870
Number of successful extensions: 3
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 44
length of database: 328,796
effective HSP length: 17
effective length of query: 27
effective length of database: 307,835
effective search space:  8311545
effective search space used:  8311545
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)
S2: 31 (16.5 bits)