RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781142|ref|YP_003065555.1| hypothetical protein CLIBASIA_05230 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) >gnl|CDD|110081 pfam01054, MMTV_SAg, Mouse mammary tumour virus superantigen. The mouse mammary tumour virus (MMTV) is a milk-transmitted type B retrovirus. The superantigen (SAg) is encoded by the long terminal repeat. The SAgs are also called PR73. Length = 314 Score = 27.3 bits (60), Expect = 0.93 Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 17 NRRQSLGSLLITVLKNARVPIKILMGQRNQLTM 49 N+ +G LLIT+L+N +P + Q +L M Sbjct: 131 NKTNPIGRLLITMLRNESLPFSTIFTQIQRLEM 163 >gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 336 Score = 27.1 bits (61), Expect = 1.0 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query: 29 VLKNARVPIKILMGQRNQL-TMIKFLFLHMIRTLIDQV 65 + K A + I +G R Q M + + H IR +ID+V Sbjct: 274 LTKGATL-RGIAVGSRAQFEAMNRAIEAHRIRPVIDRV 310 >gnl|CDD|112090 pfam03260, Lipoprotein_11, Lepidopteran low molecular weight (30 kD) lipoprotein. Length = 253 Score = 25.1 bits (55), Expect = 3.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 26 LITVLKNARVPIKILMGQRNQ 46 I + +N RV KIL +RNQ Sbjct: 145 FIPLWENNRVYFKILNTERNQ 165 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.329 0.140 0.379 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 883,704 Number of extensions: 37052 Number of successful extensions: 116 Number of sequences better than 10.0: 1 Number of HSP's gapped: 116 Number of HSP's successfully gapped: 6 Length of query: 82 Length of database: 6,263,737 Length adjustment: 52 Effective length of query: 30 Effective length of database: 5,140,069 Effective search space: 154202070 Effective search space used: 154202070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (23.6 bits)