RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] (76 letters) >gnl|CDD|112515 pfam03705, CheR_N, CheR methyltransferase, all-alpha domain. CheR proteins are part of the chemotaxis signaling mechanism in bacteria. CheR methylates the chemotaxis receptor at specific glutamate residues. CheR is an S-adenosylmethionine- dependent methyltransferase. Length = 57 Score = 28.6 bits (65), Expect = 0.36 Identities = 6/46 (13%), Positives = 17/46 (36%) Query: 23 HLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFN 68 ++ + G++ + + R A+G+++ EY Sbjct: 4 DFERFRELLYKRTGIDLTDYKRALVKRRLLRRMRALGLESFAEYLR 49 >gnl|CDD|31543 COG1352, CheR, Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms]. Length = 268 Score = 28.7 bits (64), Expect = 0.39 Identities = 13/56 (23%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 23 HLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFN--NPDSEQWN 76 + I G++ T +Y ++R +G++N EY N DSE+ Sbjct: 3 DFKRIAALIYQRTGIDFDNYKRTLVYRRLSRRLRKLGLKNFEEYLNLLESDSEELQ 58 >gnl|CDD|37002 KOG1791, KOG1791, KOG1791, Uncharacterized conserved protein [Function unknown]. Length = 1758 Score = 26.5 bits (58), Expect = 1.6 Identities = 15/63 (23%), Positives = 20/63 (31%), Gaps = 4/63 (6%) Query: 9 LGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTT----HLYNGIARLAEAVGVQNVN 64 L S + I LL+L + GL N T L IA L + + Sbjct: 93 LSSDTKTDTIGSGLILLSLTDTKVVYRGLINMGAQLTLFILRLLKHIANLNNGQHITELV 152 Query: 65 EYF 67 Y Sbjct: 153 HYV 155 >gnl|CDD|111017 pfam02075, RuvC, Crossover junction endodeoxyribonuclease RuvC. Length = 148 Score = 26.2 bits (58), Expect = 1.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Query: 7 IGLGSGNREKDIMMVSHLLALQKEI 31 G GS ++ + MV LL L + Sbjct: 109 TGNGSADKRQVQHMVKRLLNLTAKP 133 >gnl|CDD|31159 COG0817, RuvC, Holliday junction resolvasome, endonuclease subunit [DNA replication, recombination, and repair]. Length = 160 Score = 25.6 bits (56), Expect = 2.9 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 15/59 (25%) Query: 7 IGLGSGNREKDIMMVSHLLALQK-------EILATFGLNNPFVSTTHLYNGIARLAEAV 58 +G G ++E+ MV LL L++ + LA ++ TH + ARLA + Sbjct: 109 VGNGKADKEQVQHMVKRLLGLEEPPPADAADALA--------IAITHAHRAQARLAVGL 159 >gnl|CDD|38727 KOG3518, KOG3518, KOG3518, Putative guanine nucleotide exchange factor [General function prediction only]. Length = 521 Score = 24.7 bits (53), Expect = 5.3 Identities = 9/38 (23%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Query: 41 FVSTTHLYNG--IARLAEAVGVQNVNEYFNNPDSEQWN 76 F+ ++ + A G +N +E NPD N Sbjct: 61 FIPARPGFSSAELQLDNPAGGDENADEGAENPDRAISN 98 >gnl|CDD|145664 pfam02628, COX15-CtaA, Cytochrome oxidase assembly protein. This is a family of integral membrane proteins. CtaA is required for cytochrome aa3 oxidase assembly in Bacillus subtilis. COX15 is required for cytochrome c oxidase assembly in yeast. Length = 298 Score = 24.5 bits (54), Expect = 6.3 Identities = 8/22 (36%), Positives = 10/22 (45%) Query: 34 TFGLNNPFVSTTHLYNGIARLA 55 T GL +P+ HL LA Sbjct: 122 TSGLVSPYRLAAHLLLAFLLLA 143 >gnl|CDD|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.. Length = 355 Score = 24.1 bits (53), Expect = 8.0 Identities = 11/37 (29%), Positives = 14/37 (37%), Gaps = 12/37 (32%) Query: 32 LATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFN 68 LA PFV+T H G +VN +N Sbjct: 95 LAARRTRPPFVTTVH------------GFYSVNFRYN 119 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.132 0.382 Gapped Lambda K H 0.267 0.0838 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 889,130 Number of extensions: 37016 Number of successful extensions: 81 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 11 Length of query: 76 Length of database: 6,263,737 Length adjustment: 46 Effective length of query: 30 Effective length of database: 5,269,723 Effective search space: 158091690 Effective search space used: 158091690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.2 bits)