RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] (76 letters) >1tlh_B Sigma-70, RNA polymerase sigma factor RPOD; anti-sigma, transcription; NMR {Escherichia coli} (B:) Length = 81 Score = 28.5 bits (64), Expect = 0.33 Identities = 5/61 (8%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Query: 14 REKDIMMVSHLLAL-----QKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFN 68 RE ++ + + + +E+ F + + + +L + + + + Sbjct: 22 REAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQ-IEAKALRKLRHPSRSEVLRSFLD 80 Query: 69 N 69 + Sbjct: 81 D 81 >1ccw_B Protein (glutamate mutase); coenzyme B12, radical reaction, TIM- barrel, rossman-fold; HET: TAR CNC; 1.60A {Clostridium cochlearium} (B:1-409) Length = 409 Score = 26.2 bits (58), Expect = 1.6 Identities = 27/92 (29%), Positives = 36/92 (39%), Gaps = 24/92 (26%) Query: 6 NIGLG---SGNREKDIMMVSHLLALQKEILATFGLNNPFVSTT-HLYNG----------- 50 NI +G GN +DI + L E L +G N+ FV+T H + G Sbjct: 247 NITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFG 306 Query: 51 -------IARLAEA--VGVQNVNEYFNNPDSE 73 IA LA A V V+ +E P E Sbjct: 307 VIVTATTIAALAGATKVIVKTPHEAIGIPTKE 338 >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} (A:1-86) Length = 86 Score = 25.5 bits (56), Expect = 2.3 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 23 HLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYF----NNPDSEQWN 76 H + + I G+ +YN + R A+G+ + Y N +S +W Sbjct: 16 HFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSAEWQ 73 >1xm5_A Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} (A:) Length = 155 Score = 24.5 bits (53), Expect = 4.7 Identities = 8/27 (29%), Positives = 13/27 (48%), Gaps = 5/27 (18%) Query: 15 EKDIMMVSHLLALQKEILATFGLNNPF 41 E + M AL+ EI+ G +P+ Sbjct: 129 EAEEM-----EALETEIMLALGYEDPY 150 >1xax_A Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} (A:) Length = 154 Score = 24.5 bits (53), Expect = 5.2 Identities = 6/27 (22%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Query: 15 EKDIMMVSHLLALQKEILATFGLNNPF 41 E + M +L+ +I+ G ++P+ Sbjct: 129 EAEEM-----ESLETQIMQGLGFDDPY 150 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.132 0.382 Gapped Lambda K H 0.267 0.0591 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 540,049 Number of extensions: 18310 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 5 Length of query: 76 Length of database: 4,956,049 Length adjustment: 41 Effective length of query: 35 Effective length of database: 3,570,044 Effective search space: 124951540 Effective search space used: 124951540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)