RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] (76 letters) >d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} Length = 152 Score = 25.4 bits (55), Expect = 1.5 Identities = 6/18 (33%), Positives = 12/18 (66%) Query: 26 ALQKEILATFGLNNPFVS 43 AL+ EI+ G +P+++ Sbjct: 135 ALETEIMLALGYEDPYIA 152 >d1af7a1 a.58.1.1 (A:11-91) Chemotaxis receptor methyltransferase CheR, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 81 Score = 24.7 bits (54), Expect = 2.2 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 23 HLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYF----NNPDSEQWN 76 H + + I G+ +YN + R A+G+ + Y N +S +W Sbjct: 16 HFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSAEWQ 73 >d2prra1 a.152.1.3 (A:5-194) Uncharacterized protein Reut_A2532 {Ralstonia eutropha [TaxId: 106590]} Length = 190 Score = 24.4 bits (52), Expect = 2.4 Identities = 6/27 (22%), Positives = 14/27 (51%) Query: 42 VSTTHLYNGIARLAEAVGVQNVNEYFN 68 + T + R+A +G++ +E+F Sbjct: 158 AAITAFFGLSNRMANTIGMRPNDEFFL 184 >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Score = 23.8 bits (50), Expect = 3.9 Identities = 5/18 (27%), Positives = 12/18 (66%) Query: 28 QKEILATFGLNNPFVSTT 45 +++I+ GLN+P + + Sbjct: 189 RQDIVRLLGLNDPLIQIS 206 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.132 0.382 Gapped Lambda K H 0.267 0.0494 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 270,381 Number of extensions: 9968 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22 Number of HSP's successfully gapped: 6 Length of query: 76 Length of database: 2,407,596 Length adjustment: 43 Effective length of query: 33 Effective length of database: 1,817,206 Effective search space: 59967798 Effective search space used: 59967798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.4 bits)