BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] (76 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] Length = 76 Score = 158 bits (399), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 1 MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGV 60 MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGV Sbjct: 1 MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGV 60 Query: 61 QNVNEYFNNPDSEQWN 76 QNVNEYFNNPDSEQWN Sbjct: 61 QNVNEYFNNPDSEQWN 76 >gi|254780556|ref|YP_003064969.1| hypothetical protein CLIBASIA_02215 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 22.3 bits (46), Expect = 1.8, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 52 ARLAEAVGVQNVNEYFNNPDSE 73 ARL + +G+ ++ YF N DS+ Sbjct: 69 ARLLKGLGMDDLVRYFMNLDSQ 90 >gi|254780140|ref|YP_003064553.1| putative ABC transporter, substrate-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 452 Score = 21.9 bits (45), Expect = 1.9, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 39 NPFVSTTHLYNGIARLAEAVGVQNVNEYFNN 69 N F + T L + ++ +A+ +Q VN+ N Sbjct: 215 NTFNTITDLITSLDKMIKAIDLQKVNQILEN 245 >gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter asiaticus str. psy62] Length = 106 Score = 21.9 bits (45), Expect = 2.1, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 14/27 (51%) Query: 48 YNGIARLAEAVGVQNVNEYFNNPDSEQ 74 Y GI LA+ Q++ EY N P Q Sbjct: 48 YKGIDVLADDALRQSIKEYSNWPTIPQ 74 >gi|254780504|ref|YP_003064917.1| glucose-6-phosphate 1-dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 21.2 bits (43), Expect = 3.4, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 12/15 (80%) Query: 55 AEAVGVQNVNEYFNN 69 AE +GV++ +Y+NN Sbjct: 218 AETIGVEDRVDYYNN 232 >gi|254781115|ref|YP_003065528.1| poly(A) polymerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 416 Score = 20.8 bits (42), Expect = 4.6, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 30 EILATFGLNNPFVSTTHLYNG 50 EI NP + H+YNG Sbjct: 208 EINKLLEAKNPLNAIVHMYNG 228 >gi|254781054|ref|YP_003065467.1| ribose-5-phosphate isomerase A [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Score = 20.8 bits (42), Expect = 4.7, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 7 IGLGSGNREKDIMMVSHLLALQKEILATFGLN 38 +G G E D V+ L+ KE+ + FGLN Sbjct: 128 LGRGMLPIEIDQFGVNKTLSALKEVASCFGLN 159 >gi|254780654|ref|YP_003065067.1| Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 333 Score = 20.0 bits (40), Expect = 6.9, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 35 FGLNNPFVSTTHLYNGIARLAEA 57 FG+ +++T H Y G + +A Sbjct: 167 FGIEKGYMTTVHSYTGDQHVLDA 189 >gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 563 Score = 20.0 bits (40), Expect = 8.0, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 28 QKEILATFGLNNPFVSTTHLYNGIARLAEAVGV 60 +KE + + +N ++TTH + RL+ AV V Sbjct: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.132 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,690 Number of Sequences: 1233 Number of extensions: 1572 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 76 length of database: 328,796 effective HSP length: 46 effective length of query: 30 effective length of database: 272,078 effective search space: 8162340 effective search space used: 8162340 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)