BLAST/PSIBLAST alignment of GI: 254781145 and GI: 227822448 at iteration 1
>gi|227822448|ref|YP_002826420.1| hypothetical protein NGR_c19030 [Sinorhizobium fredii NGR234] Length = 684
>gi|227341449|gb|ACP25667.1| hypothetical protein NGR_c19030 [Sinorhizobium fredii NGR234] Length = 684
 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/357 (52%), Positives = 249/357 (69%), Gaps = 16/357 (4%)

Query: 10  LIKDSDVEVLEHSHREDGGEK--------VHDLRIRRKYSQGKVCVDAVSPDEFLIHPDS 61
           LI D +VEV+E S   +  E          + ++IRR+  +G   + AV  +EFLIHP++
Sbjct: 156 LIGDDEVEVVEQSRTTEKIETPQGMVEQPSYSVKIRRRLERGTPRLAAVPLEEFLIHPEA 215

Query: 62  VDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQ-------YS 114
           + I  SPI G    + RSDLI+ GYDR+ I  LP  +  +  +  +F + +         
Sbjct: 216 ISIADSPIAGIATRMRRSDLIATGYDRDLIEGLPASTGDSGRDDEEFTRRRGVFEAKDAV 275

Query: 115 DKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAP 174
            KALE ++YYELYV +D D DGIAELRR+++AGGTG++++L NEEW+E+PF  L   R P
Sbjct: 276 PKALEEVDYYELYVKVDADDDGIAELRRLVLAGGTGEEHLLSNEEWDEVPFADLIIERRP 335

Query: 175 HCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPI 234
           H   G S+   + EIQ++KTVL+RQTLDNLYWQN  Q IVQEG+I +PESVLNP+F +PI
Sbjct: 336 HQREGGSVTDDMAEIQRVKTVLMRQTLDNLYWQNNQQPIVQEGAIANPESVLNPKFAQPI 395

Query: 235 RVAAGMDIRSVLGIHSVPMIEK-SFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATA 293
           RV+ G+D R+ LG   VP + K SF+ML YLDQE  DRTGISD SSG +P+ L NMTA A
Sbjct: 396 RVSQGIDARAALGYTMVPFVAKESFAMLSYLDQEATDRTGISDASSGLAPDALTNMTARA 455

Query: 294 TSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY 350
           T+LIEQ+G+GQ EL+VRT AQGL  +F+GLLRL+I+HQD+ R VRLR QWV+FDPR+
Sbjct: 456 TALIEQAGIGQTELMVRTFAQGLRRVFKGLLRLVIKHQDRPRAVRLRGQWVTFDPRH 512