>gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62]
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSASS