Query         gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 122
No_of_seqs    9 out of 11
Neff          1.6 
Searched_HMMs 23785
Date          Wed Jun  1 01:32:30 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781146.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3fxd_A Protein ICMQ; helix bun  65.2     3.7 0.00016   21.7   2.8   20   79-98      3-22  (57)
  2 2gl7_C B-cell lymphoma 9 prote  53.2     6.5 0.00027   20.0   2.3   32   77-108     1-36  (46)
  3 2gsv_A Hypothetical protein YV  35.1      23 0.00095   16.4   2.8   54   34-101    10-67  (80)
  4 2j9w_A VPS28, VPS28-PROV prote  31.1      29  0.0012   15.6   3.3   27   77-103    73-99  (102)
  5 1veh_A NIFU-like protein hirip  30.9      15 0.00062   17.7   1.2   22   81-102     9-31  (92)
  6 2j9u_A VPS28, vacuolar protein  30.8      30  0.0013   15.6   3.1   26   77-102    68-93  (96)
  7 2zy9_A Mg2+ transporter MGTE;   29.1      32  0.0013   15.4   3.2   55   34-92     44-98  (473)
  8 1eys_L Photosynthetic reaction  16.1      57  0.0024   13.7   2.0   32   22-55    181-212 (280)
  9 1i16_A Interleukin 16, LCF; cy  15.9      44  0.0019   14.4   1.2   31   64-94     76-106 (130)
 10 3kp1_E D-ornithine aminomutase  15.5      60  0.0025   13.6   3.5   36   71-106     7-43  (121)

No 1  
>3fxd_A Protein ICMQ; helix bundle, helix-turn-helix, unknown function; 2.10A {Legionella pneumophila str} PDB: 3fxe_A
Probab=65.17  E-value=3.7  Score=21.66  Aligned_cols=20  Identities=40%  Similarity=0.654  Sum_probs=18.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHH
Q ss_conf             01688999999998899888
Q gi|254781146|r   79 DQLTDEQLCEIIRSLEKELQ   98 (122)
Q Consensus        79 D~LSDEQl~erIRaLd~aiR   98 (122)
                      |.||+||.-++..+||-||.
T Consensus         3 d~l~~eq~~aILkaLdeaIe   22 (57)
T 3fxd_A            3 DQLSDEQKETILKALNDAIE   22 (57)
T ss_dssp             -CCCHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHH
T ss_conf             04329999999999999998


No 2  
>2gl7_C B-cell lymphoma 9 protein; protein complex, armadillo repeat, transcription; 2.60A {Homo sapiens}
Probab=53.24  E-value=6.5  Score=20.05  Aligned_cols=32  Identities=41%  Similarity=0.390  Sum_probs=22.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHH--H--HHHCCHHHHC
Q ss_conf             410168899999999889988--8--8731101111
Q gi|254781146|r   77 NGDQLTDEQLCEIIRSLEKEL--Q--IFTDFKNKDA  108 (122)
Q Consensus        77 ~~D~LSDEQl~erIRaLd~ai--R--pf~~~k~r~~  108 (122)
                      |-|+||.|||-.|-|+|.+--  +  -|-|.|.-++
T Consensus         1 npdglsqeqlehrerslqtlrdiqrmlfpd~k~~a~   36 (46)
T 2gl7_C            1 NPDGLSQEQLEHRERSLQTLRDIQRMLFPDEKEFTG   36 (46)
T ss_dssp             -----CHHHHHHHHHHHHHHHHHHHHHC--------
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             953021899999999999999999987667533114


No 3  
>2gsv_A Hypothetical protein YVFG; alpha-helical protein, structural genomics, PSI, protein structure initiative; 1.90A {Bacillus subtilis} SCOP: a.23.7.1 PDB: 2js1_A
Probab=35.07  E-value=23  Score=16.41  Aligned_cols=54  Identities=19%  Similarity=0.283  Sum_probs=32.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHC---HHHHHHHHHHHCCHHHHHHHCCCCCCCCC-HHHHHHHHHHHHHHHHHHH
Q ss_conf             43689985599999997448---79999999997461455542454410168-8999999998899888873
Q gi|254781146|r   34 LTDDFSKYGRKVIKNLREEK---PEQYLRLISQILPREKIKQDGITNGDQLT-DEQLCEIIRSLEKELQIFT  101 (122)
Q Consensus        34 l~dDF~~hG~~vIarvReeK---PeqYLKlVaSiLPkdl~~~~gin~~D~LS-DEQl~erIRaLd~aiRpf~  101 (122)
                      +-++|++|-.---   -|+|   -..|.|.|+|-|-.|           +|+ .--++-|||-||.|-+-.-
T Consensus        10 f~~N~k~~i~mn~---~~dKIhAmNaYYrsVvstlvqD-----------qltKNA~vlkRiqHLdEAYqKVk   67 (80)
T 2gsv_A           10 FIENLKQHIEMNQ---SEDKIHAMNSYYRSVVSTLVQD-----------QLTKNAVVLKRIQHLDEAYNKVK   67 (80)
T ss_dssp             HHHHHHHHHHHCS---SSCHHHHHHHHHHHHHHHHHHC-----------SSSCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999998590---0889999999999999999999-----------99730799999999999999998


No 4  
>2j9w_A VPS28, VPS28-PROV protein; MVB, CHMP, ESCRT, NZF finger, HIV budding, protein transport; 1.30A {Xenopus laevis}
Probab=31.14  E-value=29  Score=15.63  Aligned_cols=27  Identities=30%  Similarity=0.541  Sum_probs=23.2

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             410168899999999889988887311
Q gi|254781146|r   77 NGDQLTDEQLCEIIRSLEKELQIFTDF  103 (122)
Q Consensus        77 ~~D~LSDEQl~erIRaLd~aiRpf~~~  103 (122)
                      -.|+|++||.++-+--||+|-.-|...
T Consensus        73 AsdeL~e~q~RqllfDle~aY~~F~~~   99 (102)
T 2j9w_A           73 ASDELDDSQVRQMLFDLESAYNAFNRF   99 (102)
T ss_dssp             TTCBCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             020059999999999999999999998


No 5  
>1veh_A NIFU-like protein hirip5; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.52.8.1
Probab=30.86  E-value=15  Score=17.66  Aligned_cols=22  Identities=14%  Similarity=0.380  Sum_probs=17.4

Q ss_pred             CCHHHHHHHHHH-HHHHHHHHHC
Q ss_conf             688999999998-8998888731
Q gi|254781146|r   81 LTDEQLCEIIRS-LEKELQIFTD  102 (122)
Q Consensus        81 LSDEQl~erIRa-Ld~aiRpf~~  102 (122)
                      =.|++++++|.. ||..|||++.
T Consensus         9 ~~d~e~~~~I~~~L~~~IrP~l~   31 (92)
T 1veh_A            9 EEDDEVVAMIKELLDTRIRPTVQ   31 (92)
T ss_dssp             SSCCHHHHHHHHHHHHTTHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHCCHHHH
T ss_conf             76389999999999975167899


No 6  
>2j9u_A VPS28, vacuolar protein sorting-associated protein 28; MVB, zinc, CHMP, ESCRT, membrane, transport, NZF finger, HIV budding, zinc-finger; 2.00A {Saccharomyces cerevisiae} SCOP: a.24.28.1 PDB: 2j9v_A 2g3k_A
Probab=30.82  E-value=30  Score=15.60  Aligned_cols=26  Identities=35%  Similarity=0.480  Sum_probs=22.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             41016889999999988998888731
Q gi|254781146|r   77 NGDQLTDEQLCEIIRSLEKELQIFTD  102 (122)
Q Consensus        77 ~~D~LSDEQl~erIRaLd~aiRpf~~  102 (122)
                      -.|+|++||.++-.--||++-.-|..
T Consensus        68 AsdeL~e~q~RqllfDle~aY~~F~~   93 (96)
T 2j9u_A           68 IGDTLTETQIRELLFDLELAYKSFYA   93 (96)
T ss_dssp             TTCBCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             12016999999999999999999999


No 7  
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A
Probab=29.12  E-value=32  Score=15.41  Aligned_cols=55  Identities=16%  Similarity=0.248  Sum_probs=36.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             43689985599999997448799999999974614555424544101688999999998
Q gi|254781146|r   34 LTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRS   92 (122)
Q Consensus        34 l~dDF~~hG~~vIarvReeKPeqYLKlVaSiLPkdl~~~~gin~~D~LSDEQl~erIRa   92 (122)
                      |..-+.+.-|.-||.+=|+=|..+-..+.+.||.+..+++=    .+|+++...+.+..
T Consensus        44 l~~~L~~lhpaDiA~~le~L~~~~r~~l~~~L~~~~~aevl----~el~~~~~~~ll~~   98 (473)
T 2zy9_A           44 LREVLEEIHPQDLLALWDELKGEHRYVVLTLLPKAKAAEVL----SHLSPEEQAEYLKT   98 (473)
T ss_dssp             --CCTTTSCHHHHHHGGGGSCHHHHHHHHHHSCHHHHHHHT----TSSCHHHHHHHHHH
T ss_pred             HHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHH----HCCCHHHHHHHHHH
T ss_conf             99999849999999999819999999999959975688999----82999999999995


No 8  
>1eys_L Photosynthetic reaction center; membrane protein complex, electron transport; HET: BGL BCL BPH MQ8 HEM CRT LDA PEF; 2.20A {Thermochromatium tepidum} SCOP: f.26.1.1
Probab=16.12  E-value=57  Score=13.68  Aligned_cols=32  Identities=13%  Similarity=0.384  Sum_probs=27.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHH
Q ss_conf             5668999999974368998559999999744879
Q gi|254781146|r   22 KEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPE   55 (122)
Q Consensus        22 ~~~~~~~~~~~~l~dDF~~hG~~vIarvReeKPe   55 (122)
                      .-+|...+|-|.|-  |+-||.-+.+-.|+++.|
T Consensus       181 HmlsIaflygsaLl--~AmHGatILa~s~~~~~~  212 (280)
T 1eys_L          181 HMLAISFFFTNCLA--LSMHGSLILSVTNPQRGE  212 (280)
T ss_dssp             HHHHHHHHHHHHHH--HHHHHHHHHHHSSCSTTC
T ss_pred             HHHHHHHHHHHHHH--HHHHHCEEECCCCCCCCC
T ss_conf             99999998740999--987305244033789885


No 9  
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2
Probab=15.93  E-value=44  Score=14.43  Aligned_cols=31  Identities=32%  Similarity=0.338  Sum_probs=27.4

Q ss_pred             HCCHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7461455542454410168899999999889
Q gi|254781146|r   64 ILPREKIKQDGITNGDQLTDEQLCEIIRSLE   94 (122)
Q Consensus        64 iLPkdl~~~~gin~~D~LSDEQl~erIRaLd   94 (122)
                      +.|-|.+.+++..++..++-+|.++.||+..
T Consensus        76 l~~GD~Il~INg~~v~~~t~~e~v~~lr~~~  106 (130)
T 1i16_A           76 VQPGDEILQLGGTAMQGLTRFEAWNIIKALP  106 (130)
T ss_dssp             CCTTCCEEECSSCBGGGSCHHHHHHHHHTSC
T ss_pred             CCCCCEEEEECCEECCCCCHHHHHHHHHCCC
T ss_conf             9878999999999988997999999997189


No 10 
>3kp1_E D-ornithine aminomutase S component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_E* 3koy_E* 3koz_E* 3kp0_E* 3kox_E*
Probab=15.46  E-value=60  Score=13.58  Aligned_cols=36  Identities=25%  Similarity=0.244  Sum_probs=27.8

Q ss_pred             HHHCCCCCCCCCHHHHHHHHHHH-HHHHHHHHCCHHH
Q ss_conf             54245441016889999999988-9988887311011
Q gi|254781146|r   71 KQDGITNGDQLTDEQLCEIIRSL-EKELQIFTDFKNK  106 (122)
Q Consensus        71 ~~~gin~~D~LSDEQl~erIRaL-d~aiRpf~~~k~r  106 (122)
                      |..--.++-+||||+|-+|.-.| |+..-|++++-+.
T Consensus         7 Fe~RrkhL~~ltdeeL~~rFW~LaekiVdPliela~~   43 (121)
T 3kp1_E            7 FQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKK   43 (121)
T ss_dssp             HHHHTGGGTTCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999986789999999999999987599999761


Done!