BLAST/PSIBLAST alignment of GI: 254781146 and GI: 13471715 at iteration 1
>gi|13471715|ref|NP_103282.1| hypothetical protein mll1773 [Mesorhizobium loti MAFF303099] Length = 130
>gi|14022459|dbj|BAB49068.1| mll1773 [Mesorhizobium loti MAFF303099] Length = 130
 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 30  YQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEI 89
           + + +  DF  +G  VI  +R +KP+QYL+++  +LPR+      I + D L+DE++   
Sbjct: 43  FLAAVRADFRAHGAGVIAEVRADKPDQYLKIVLSVLPRD--FDVAINHLDALSDEEIRSR 100

Query: 90  IRSLEKELQIF 100
           IR LE  L+ F
Sbjct: 101 IRGLETVLRPF 111