RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >gnl|CDD|150154 pfam09385, HisK_N, Histidine kinase N terminal. This domain is found at the N terminal of sensor histidine kinase proteins. Length = 133 Score = 28.9 bits (65), Expect = 0.36 Identities = 15/74 (20%), Positives = 35/74 (47%), Gaps = 11/74 (14%) Query: 11 KKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKN-----------LREEKPEQYLR 59 K+ C HKE L+ + ++ + Y ++++N L EE E+Y++ Sbjct: 5 KQKLCTFLKEHKEKFLENWKKKMVIAEDDPYKEEIVQNGEALLELFIEALLEELSEEYIQ 64 Query: 60 LISQILPREKIKQD 73 +++ + +E+ + D Sbjct: 65 RLAEKIAKERAEAD 78 >gnl|CDD|178477 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthase. Length = 918 Score = 27.9 bits (62), Expect = 0.75 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Query: 26 LQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKI 70 LQ+ +S+ T YGR++ KN RE + +LRL S L R Sbjct: 312 LQFHPESIAT----CYGRQIFKNFREITQDYWLRLRSTSLRRRNS 352 >gnl|CDD|166513 PLN02872, PLN02872, triacylglycerol lipase. Length = 395 Score = 27.5 bits (61), Expect = 0.80 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Query: 25 SLQYLYQSVLTDDFSKYGRKVIKNLRE----EKPEQYLRLISQILP 66 +L++L+Q + F+ Y + KNL+ P L LI + LP Sbjct: 282 NLRHLFQMIRKGTFAHYDYGIFKNLKLYGQVNPPAFDLSLIPKSLP 327 >gnl|CDD|162647 TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleotidase. These enzymes are members of the haloacid dehalogenase (HAD) superfamily of hydrolases, specifically the IA subfamily (variant 3, TIGR01509). Length = 184 Score = 26.6 bits (59), Expect = 1.9 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 10/49 (20%) Query: 54 PEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTD 102 ++YLR + LP EK+K D +L ++ L IFT+ Sbjct: 67 ADEYLRYVHGRLPYEKLKP----------DPELRNLLLRLPGRKIIFTN 105 >gnl|CDD|132308 TIGR03264, met_CoM_red_C, methyl-coenzyme M reductase I operon protein C. has several modified sites, so accessory proteins are expected. Several methanogens have encode two such enzymes, designated I and II; this protein occurs only operons of type I. The precise function is unknown. Length = 194 Score = 25.5 bits (56), Expect = 3.3 Identities = 14/62 (22%), Positives = 29/62 (46%), Gaps = 9/62 (14%) Query: 36 DDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEK 95 +DF+K G K + + +P+ ++ + G+ G+ E++ EIIR ++ Sbjct: 142 EDFAKIGVKT-RAVMPLEPKTKGTVVEIV--------TGVIRGESCPQEKIDEIIRKVKT 192 Query: 96 EL 97 L Sbjct: 193 HL 194 >gnl|CDD|181210 PRK08053, PRK08053, sulfur carrier protein ThiS; Provisional. Length = 66 Score = 25.0 bits (55), Expect = 4.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 49 LREEKPEQYLRLISQILPREKIKQDGITNGDQL 81 L + +P L + QI+PRE+ Q + +GDQ+ Sbjct: 25 LNQLQPGAALAINQQIIPREQWAQHIVQDGDQI 57 >gnl|CDD|184869 PRK14867, PRK14867, DNA topoisomerase VI subunit B; Provisional. Length = 659 Score = 25.2 bits (55), Expect = 5.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Query: 43 RKVIKNLREEKPEQYLRLISQILPREKI 70 ++V N RE+ P +YLR IS P KI Sbjct: 178 KEVTYNRREQGPFEYLRRISLSTPHAKI 205 >gnl|CDD|117046 pfam08469, NPHI_C, Nucleoside triphosphatase I C-terminal. This viral domain is found to the C-terminus of Poxvirus nucleoside triphosphatase phosphohydrolase I (NPH I) together with the helicase conserved C-terminal domain (pfam00271). Length = 148 Score = 25.0 bits (55), Expect = 5.7 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 76 TNGDQLTDEQLCEIIRSLEKEL-QIFTDFK 104 +NG DE L +II+ KE Q+F K Sbjct: 21 SNGRPSVDEDLLDIIKDKSKEFNQLFKVLK 50 >gnl|CDD|161791 TIGR00260, thrC, threonine synthase. Involved in threonine biosynthesis it catalyses the reaction O-PHOSPHO-L-HOMOSERINE + H(2)O = L-THREONINE + ORTHOPHOSPHATE using pyridoxal phosphate as a cofactor. the enzyme is distantly related to the serine/threonine dehydratases which are also pyridoxal-phosphate dependent enzymes. the pyridoxal-phosphate binding site is a Lys (K) residues present at residue 70 of the model. Length = 328 Score = 24.7 bits (54), Expect = 6.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 77 NGDQLTDEQLCEIIRSLEKELQIFTD 102 N + ++DE++ E I+ L +E F + Sbjct: 265 NAEDVSDEEILEAIKLLAREEGYFVE 290 >gnl|CDD|180239 PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated. Length = 177 Score = 24.7 bits (55), Expect = 6.4 Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 5/71 (7%) Query: 32 SVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGD-----QLTDEQL 86 + + S+Y + +K L E L I + + + + I + + L++EQL Sbjct: 63 AAVFKSLSEYVQNFLKVLAENGRLALLPEILEQFEALRAEHENIVDAEVTSAFPLSEEQL 122 Query: 87 CEIIRSLEKEL 97 ++ +LEK L Sbjct: 123 DKLKAALEKRL 133 >gnl|CDD|148181 pfam06421, LepA_C, GTP-binding protein LepA C-terminus. This family consists of the C-terminal region of several pro- and eukaryotic GTP-binding LepA proteins. Length = 108 Score = 24.1 bits (53), Expect = 9.1 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Query: 36 DDFSKYGRKVIKNLREEKPEQYLRLI------SQILPREKIKQ 72 D GR++++ L+E P Q + S+I+ RE IK Sbjct: 16 DKAYNRGRELVEKLKELIPRQQFEIPIQAAIGSKIIARETIKA 58 >gnl|CDD|180189 PRK05667, dnaG, DNA primase; Validated. Length = 580 Score = 24.0 bits (53), Expect = 9.2 Identities = 13/71 (18%), Positives = 35/71 (49%) Query: 26 LQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQ 85 + L +++L G +++++LR+ E+ L+ + E+I ++ I ++ + Sbjct: 475 FRALLEAILAQPGLTTGSQLLEHLRDAGLEELAALLESLAVWEEISEEDIAALEKELKDA 534 Query: 86 LCEIIRSLEKE 96 L ++ L +E Sbjct: 535 LEKLRDQLLEE 545 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.132 0.362 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,895,918 Number of extensions: 111023 Number of successful extensions: 248 Number of sequences better than 10.0: 1 Number of HSP's gapped: 246 Number of HSP's successfully gapped: 37 Length of query: 122 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 40 Effective length of database: 4,222,617 Effective search space: 168904680 Effective search space used: 168904680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.5 bits)