HHsearch results for GI: 254781147 and protein with PDBid: 1jye_A

>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ...
Probab=94.17  E-value=0.0069  Score=36.69  Aligned_cols=45  Identities=11%  Similarity=0.097  Sum_probs=35.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHH---HHHHHHHHCCCH
Q ss_conf             399499999986342999988755899944899---999999928999
Q gi|254781147|r   33 AKLTQKEIRNRTGFAQSWISELETGKSTINIDN---MIILAHTLDTPL   77 (83)
Q Consensus        33 ~gltq~ela~~~gis~~~is~iE~G~~~~~~~~---l~~la~al~i~~   77 (83)
                      ++.|.+|+|+.+|||.+|+|++-||+..++-++   +.++++-+|..+
T Consensus         2 kk~Ti~dIA~~aGVS~sTVSraLn~~~~Vs~~tr~rV~~~a~~lgY~p   49 (349)
T 1jye_A            2 KPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIP   49 (349)
T ss_dssp             ------------------------------------------------
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             977699999998869999999967969999999999999999978985