HHsearch results for GI: 254781147 and protein with PDBid: 1r69_A

>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A
Probab=99.39  E-value=4.8e-13  Score=96.99  Aligned_cols=60  Identities=28%  Similarity=0.305  Sum_probs=57.3

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHCC
Q ss_conf             9999999999839949999998634299998875589994489999999992899999608
Q gi|254781147|r   22 FVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLK   82 (83)
Q Consensus        22 ~g~~ir~~R~~~gltq~ela~~~gis~~~is~iE~G~~~~~~~~l~~la~al~i~~~~l~~   82 (83)
                      +|.+|+.+|+.+||||.+||+.+|+++++|++||+|+ .|+.+++.+||++|+|++++||.
T Consensus         2 ig~rik~~R~~~gltq~elA~~~gis~~~~~~~e~g~-~~~~~~l~~ia~~l~v~~~~l~~   61 (69)
T 1r69_A            2 ISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGK-TKRPRFLPELASALGVSVDWLLN   61 (69)
T ss_dssp             HHHHHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHTTS-CSSCTTHHHHHHHTTCCHHHHHH
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCC-CCCHHHHHHHHHHHCCCHHHHHC
T ss_conf             8999999999949999999886398999999998699-98999999999996988999828