HHsearch results for GI: 254781147 and protein with PDBid: 1r71_A

>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1
Probab=92.56  E-value=0.14  Score=28.93  Aligned_cols=35  Identities=11%  Similarity=0.110  Sum_probs=27.7

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999998399499999986342999988755
Q gi|254781147|r   21 IFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELET   56 (83)
Q Consensus        21 ~~g~~ir~~R~~~gltq~ela~~~gis~~~is~iE~   56 (83)
                      ..+..++.+- ..|+||+++|+++|.|++||+++-+
T Consensus        40 e~A~~~~~l~-~~g~t~~~iA~~lg~s~~~V~~~l~   74 (178)
T 1r71_A           40 EIADFIGREL-AKGKKKGDIAKEIGKSPAFITQHVT   74 (178)
T ss_dssp             HHHHHHHHHH-HTTCCHHHHHHHHTCCHHHHHHHHG
T ss_pred             HHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999999-8178899999996999999999999