HHsearch results for GI: 254781147 and protein with PDBid: 2awi_A

>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A
Probab=99.30  E-value=4.9e-12  Score=91.00  Aligned_cols=60  Identities=15%  Similarity=0.289  Sum_probs=57.4

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHC
Q ss_conf             9999999999983994999999863429999887558999448999999999289999960
Q gi|254781147|r   21 IFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLL   81 (83)
Q Consensus        21 ~~g~~ir~~R~~~gltq~ela~~~gis~~~is~iE~G~~~~~~~~l~~la~al~i~~~~l~   81 (83)
                      .+|..+|.+|+++|+||+++|+. ++|++++|+||+|+..|+++.|..|++.+||++++|+
T Consensus         3 ~iG~~~k~~R~~~~ltq~~~a~~-~~s~s~ls~~E~g~~~~s~~~l~~l~~~l~v~~~ef~   62 (317)
T 2awi_A            3 KIGSVLKQIRQELNYHQIDLYSG-IMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEIL   62 (317)
T ss_dssp             CHHHHHHHHHHHTTCCHHHHHTT-TSCHHHHHHHHTTCSCCBHHHHHHHHHHHTSCHHHHH
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHC-CCCHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHH
T ss_conf             88999999999879989999662-8999999999889987999999999998599999998