RPSBLAST alignment for GI: 254781147 and conserved domain: smart00530

>gnl|CDD|128803 smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins. Length = 56
 Score = 46.0 bits (110), Expect = 2e-06
 Identities = 17/56 (30%), Positives = 32/56 (57%)

Query: 25 NFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKL 80
            + +R+E  LTQ+E+  + G ++S +S +E GK   +++ +  LA  L   L +L
Sbjct: 1  RLKELREEKGLTQEELAEKLGVSRSTLSRIENGKRKPSLETLKKLAKALGVSLDEL 56