RPSBLAST alignment for GI: 254781147 and conserved domain: cd00093

>gnl|CDD|28977 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.. Length = 58
 Score = 46.7 bits (111), Expect = 1e-06
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 24 NNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKL 80
             + +RKE  LTQ+E+  + G ++S IS +E GK   +++ +  LA  L   L +L
Sbjct: 2  ERLKELRKEKGLTQEELAEKLGVSRSTISRIENGKRNPSLETLEKLAKALGVSLDEL 58