RPSBLAST alignment of GI: 254781147 and protein with PDBid: 2auw

>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein structure initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Length = 170
 Score = 39.9 bits (93), Expect = 1e-04
 Identities = 10/59 (16%), Positives = 16/59 (27%), Gaps = 1/59 (1%)

Query: 24  NNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINID-NMIILAHTLDTPLWKLL 81
             F +      L+        G ++  +S   T    I     +  L      P  K L
Sbjct: 93  EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGWEATRPETKTL 151