BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781147|ref|YP_003065560.1| transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] (83 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781147|ref|YP_003065560.1| transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 83 Score = 170 bits (430), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKST 60 MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKST Sbjct: 1 MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKST 60 Query: 61 INIDNMIILAHTLDTPLWKLLKP 83 INIDNMIILAHTLDTPLWKLLKP Sbjct: 61 INIDNMIILAHTLDTPLWKLLKP 83 >gi|254780943|ref|YP_003065356.1| glucosamine--fructose-6-phosphate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 608 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 18/38 (47%) Query: 1 MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQK 38 +P ++ PH + I + NF ++KE +Q+ Sbjct: 79 LPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQ 116 >gi|254780460|ref|YP_003064873.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Score = 21.9 bits (45), Expect = 1.9, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 44 TGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLK 82 TGF W+ EL G++ +++ N I + TP KL++ Sbjct: 91 TGFFLGWLGELGKGRA-VSVSN--IKFRGMVTPDCKLVE 126 >gi|254780909|ref|YP_003065322.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 20.8 bits (42), Expect = 4.3, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 16/22 (72%) Query: 28 NIRKEAKLTQKEIRNRTGFAQS 49 NI E++ TQ+++ N+T +Q+ Sbjct: 98 NIEPESQETQQQVINKTTTSQT 119 >gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 37 QKEIRNRTGFAQSWISELETGKSTI 61 ++ +RN+ S I ++ GK+T+ Sbjct: 4 KRYVRNKESLGLSTIGHVDHGKTTL 28 >gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 37 QKEIRNRTGFAQSWISELETGKSTI 61 ++ +RN+ S I ++ GK+T+ Sbjct: 4 KRYVRNKESLGLSTIGHVDHGKTTL 28 >gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 20.0 bits (40), Expect = 7.4, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 46 FAQSWISELETGKSTINIDNMIILAHTLD 74 +AQ ++ E E GK T D M + T+ Sbjct: 22 YAQPFLEETEKGKKTEITDFMTATSGTVG 50 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.135 0.398 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,507 Number of Sequences: 1233 Number of extensions: 1622 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 83 length of database: 328,796 effective HSP length: 52 effective length of query: 31 effective length of database: 264,680 effective search space: 8205080 effective search space used: 8205080 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)