RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781148|ref|YP_003065561.1| hypothetical protein CLIBASIA_05275 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) >3gxv_A Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_C (A:) Length = 123 Score = 36.0 bits (83), Expect = 0.002 Identities = 8/44 (18%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63 +E+ +L ++L + ++ + S L+ F P + F + Sbjct: 11 QNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALK 54 >2r5u_A Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis} (A:) Length = 200 Score = 35.4 bits (81), Expect = 0.003 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 19 YFIGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITRK 64 + EQ +LG +LL + + ++ L F P H V+ AI Sbjct: 29 QDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDL 75 >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A (A:1-155) Length = 155 Score = 35.0 bits (80), Expect = 0.004 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 19 YFIGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63 I EQ +LG++ L L P L + F H ++F A+ R Sbjct: 12 QSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLR 57 >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} (A:1-154) Length = 154 Score = 32.7 bits (74), Expect = 0.018 Identities = 11/44 (25%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Query: 21 IGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRK 64 EQ +LGS+L + L L +HF H ++ + Sbjct: 15 EYAEQAVLGSILTEPELIKEC-PLTPEHFSPGKHFNIYFTMQDL 57 >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} (A:1-152) Length = 152 Score = 31.9 bits (72), Expect = 0.033 Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLD-AQHFIDPIHSEVFRAITR 63 + EQ +LGS+LL + + + L + F H +++ A+ Sbjct: 10 LEAEQSVLGSILLDSDVMDEVEGLLPSPEAFYAEAHRKIYAAMQA 54 >1b79_A DNAB helicase; hexamer, DNA replication; 2.30A {Escherichia coli} (A:) Length = 119 Score = 30.3 bits (68), Expect = 0.087 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 24 EQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63 EQ +LG L+L + + A F H +F + R Sbjct: 24 EQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMAR 64 >2wsc_2 LHCA2, type II chlorophyll A/B binding protein from photosystem I; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Pisum sativum} PDB: 2wse_2* 2wsf_2* 2o01_2* (2:) Length = 269 Score = 26.5 bits (57), Expect = 1.2 Identities = 6/26 (23%), Positives = 8/26 (30%) Query: 38 QPIISFLDAQHFIDPIHSEVFRAITR 63 I L A H DP + + Sbjct: 244 TGPIDNLFAAHLADPHATIFAAFTPK 269 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.140 0.403 Gapped Lambda K H 0.267 0.0625 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 491,048 Number of extensions: 16232 Number of successful extensions: 27 Number of sequences better than 10.0: 1 Number of HSP's gapped: 23 Number of HSP's successfully gapped: 7 Length of query: 69 Length of database: 4,956,049 Length adjustment: 36 Effective length of query: 33 Effective length of database: 3,739,069 Effective search space: 123389277 Effective search space used: 123389277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.3 bits)