HHsearch alignment for GI: 254781149 and conserved domain: COG1855

>COG1855 ATPase (PilT family) [General function prediction only].
Probab=96.66  E-value=0.0019  Score=44.28  Aligned_cols=53  Identities=30%  Similarity=0.329  Sum_probs=38.9

Q ss_pred             HHHHH-HHH-CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             77765-530-16836887068741488999999999630223236411675348999
Q gi|254781149|r  132 VDHLM-GGV-QLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLG  186 (266)
Q Consensus       132 LD~~~-gG~-~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~  186 (266)
T Consensus       251 L~dkl~eRL~eraeGILIAG~PGaGKsTFaqAlAefy~~~GkiV--KTmEsPRDl~v  305 (604)
T COG1855         251 LSDKLKERLEERAEGILIAGAPGAGKSTFAQALAEFYASQGKIV--KTMESPRDLQV  305 (604)
T ss_pred             CCHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHCCCEE--EECCCCCCCCC
T ss_conf             79899999886416469956999974689999999998669688--63247513568