HHsearch alignment for GI: 254781149 and conserved domain: COG3839

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].
Probab=94.78  E-value=0.4  Score=28.07  Aligned_cols=107  Identities=13%  Similarity=0.099  Sum_probs=67.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CC-------------------------CCE---EEE
Q ss_conf             7776553016836887068741488999999999630-------22-------------------------323---641
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SG-------------------------HGV---AFF  176 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g-------------------------~~V---l~f  176 (266)
T Consensus        19 l~~i~l~i~~Gef~vllGPSGcGKSTlLr~IAGLe~p~~G~I~i~g~~vt~l~P~~R~iamVFQ~yALyPhMtV~~Niaf   98 (338)
T COG3839          19 LKDVNLDIEDGEFVVLLGPSGCGKSTLLRMIAGLEEPTSGEILIDGRDVTDLPPEKRGIAMVFQNYALYPHMTVYENIAF   98 (338)
T ss_pred             EECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHHHHH
T ss_conf             63326897479799998999888899999996887788715999999999899557888999378301578769997341


Q ss_pred             CCCCC---HHHHHHHHHHHHHCCCCCCCCHHHCCC-CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             16753---489999999963022323478555017-889989999999999999729954747998898
Q gi|254781149|r  177 SLEMD---REKLGARALSNLLYPSSSRIPYLNLIR-GEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       177 SlEMs---~~ql~~R~ls~~t~~~~s~I~~~~l~~-g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
T Consensus        99 ~Lk~~~~~k~ei~~rV~eva~~---L~l~~lL~r~P~~LSGGQrQRVAlaRAlVr~P~v~L~DEPlSnL  164 (338)
T COG3839          99 GLKLRGVPKAEIDKRVKEVAKL---LGLEHLLNRKPLQLSGGQRQRVALARALVRKPKVFLLDEPLSNL  164 (338)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHH---CCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHH
T ss_conf             6644799568889999999987---39866773590117725678999987775478878844764676